Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR305 IGR303 IGR306 IGR304 IGR308 IGR311 IGR302 IGR309 IGR310 IGR307 yfiF, - HD0438 ponA,mrcA, - HD0426 HD0428 HD0430 HD0433 nusB, - HD0435 comA, - HD0427 HD0432 suhB, - HD0440 thiL, - HD0436 comE, - HD0434 dxs, - HD0441 yfiF, - HD0438 ponA,mrcA, - HD0426 HD0428 HD0430 HD0433 nusB, - HD0435 comA, - HD0427 HD0432 suhB, - HD0440 thiL, - HD0436 comE, - HD0434 dxs, - HD0441 yfiF, - HD0438 ponA,mrcA, - HD0426 nusB, - HD0435 comA, - HD0427 suhB, - HD0440 thiL, - HD0436 comE, - HD0434 dxs, - HD0441 HD0429 HD0431 pgpA, - HD0437 pgpA, - HD0437 HD0432 HD0430 HD0433 HD0428 HD0431 HD0429
* Calculated from Protein Sequence

Gene ID: HD0436

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
thiL  

Definition:
thiamin-monophosphate kinase, thiL

Gene Start:
343060

Gene Stop:
344025

Gene Length:
966

Molecular Weight*:
35226

pI*:
5.00

Net Charge*:
-11.01

EC:
2.7.4.16  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Thiamine  

Pathway: pathway table
Thiamine metabolism

Secondary Evidence:
Webb E, Downs D.
Characterization of thiL, encoding thiamin-monophosphate kinase, in Salmonella typhimurium.
J Biol Chem. 1997 Jun 20;272(25):15702-7.
PMID: 9188462

Shikata H, Egi Y, Koyama S, Yamada K, Kawasaki T.
Properties of the thiamin triphosphate-synthesizing activity catalyzed by adenylate kinase (isoenzyme 1).
Biochem Int. 1989 May;18(5):943-9.
PMID: 2551298

Comment:


Blast Summary:  PSI-Blast Search
Residues 1 to 321 are 52% ( EScore : 7e-88 ) identical to pir||E64115 thiamin-phosphate kinase between residues 20 and 343 in [Haemophilus influenzae Rd]
Residues 1 to 321 are 52% ( EScore : 7e-88 ) identical to sp|Q57190|THIL_HAEIN between residues 3 and 326
Residues 2 to 319 are 50% ( EScore : 3e-82 ) identical to sp|P55881|THIL_SALTY THIAMINE-MONOPHOSPHATE KINASE between residues 4 and 322 in [Salmonella typhimurium]
Residues 2 to 319 are 50% ( EScore : 6e-81 ) identical to sp|P77785|THIL_ECOLI THIAMINE-MONOPHOSPHATE KINASE between residues 4 and 322 in [Escherichia coli]
Residues 2 to 319 are 50% ( EScore : 2e-80 ) identical to dbj|BAA21778.1| (D17333) thiamine-monophosphate kinase between residues 4 and 322 in [Escherichia coli]
Residues 2 to 319 are 48% ( EScore : 3e-75 ) identical to gb|AAF95410.1| (AE004298) thiamin-monophosphate kinase between residues 13 and 330 in [Vibrio cholerae]
Residues 1 to 319 are 42% ( EScore : 6e-56 ) identical to emb|CAB85319.1| (AL162758) thiamine-monophosphate kinase between residues 1 and 317 in [Neisseria meningitidis]
Residues 1 to 319 are 41% ( EScore : 9e-54 ) identical to gb|AAF40825.1| (AE002394) thiamin-monophosphate kinase between residues 1 and 317 in [Neisseria meningitidis MC58]
Residues 1 to 319 are 40% ( EScore : 1e-52 ) identical to gb|AAF83766.1|AE003934_8 thiamine-monophosphate kinase between residues 1 and 322 in [Xylella fastidiosa]
Residues 1 to 319 are 33% ( EScore : 2e-35 ) identical to dbj|BAA19714.1| (D88802) H. influenzae hypothetical protein; E64115 between residues 27 and 350 in [Bacillus subtilis]

COGS Summary:  COGS Search
BeTs to 9 clades of COG0611
COG name: Thiamine monophosphate kinase
Functional Class: H
The phylogenetic pattern of COG0611 is amtk-q-cebrh---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-118 are 60% similar to a (KINASE COMPLETE PROTEOME HYDROGENASE) protein domain (PD344351) which is seen in THIL_HAEIN.

Residues 129-319 are 46% similar to a (KINASE THIAMINE PROTEOME) protein domain (PD206980) which is seen in THIL_HAEIN.



Paralogs:  Local Blast Search
HD0436 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 147 to 302 (E-value = 2.2e-05) place HD0436 in the AIRS_C family which is described as AIR synthase related protein, C-terminal domain (PF02769)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MGEFDLIKRYFNRQLPKFGVELSIGDDCAIVAHQADTRIAISTDTLVAGS
HFLANISAADLAYKSIAVNLSDLAAMGAKPAWISLALTLDKVDHDWLAEF
SHSLFAILDRYQTTLIGGDTTRGPLALTITAQGLLPKLDALLRQNAKEGD
WIFVSGTIGDSAAGLALLLDGRKILEDDDRYLVQRHLRPTPRVELGLALR
SFSRCAIDISDGLLADLNHILESSQVGAEIYLEHLPLSTPLLNRNNREQA
EQFALTGGEDYELCFTVADDKRAEMEQVLHSQGMKVTCIGKIVAVKNGMQ
LFKYGQPVAFPTQIGFDHFNE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGGTGAATTTGATCTAATTAAACGTTATTTTAACCGTCAACTACCGAA
ATTCGGTGTTGAACTTTCAATAGGTGATGATTGTGCTATTGTTGCTCATC
AAGCAGATACAAGAATTGCGATTAGTACTGATACACTTGTGGCAGGTAGC
CATTTTTTAGCGAATATATCGGCGGCAGATCTTGCGTATAAAAGCATTGC
GGTTAATTTAAGTGATTTGGCGGCAATGGGAGCCAAGCCTGCTTGGATTT
CATTAGCATTAACGCTTGATAAGGTTGATCACGATTGGTTGGCGGAATTT
AGCCATAGTTTATTTGCAATATTAGATCGTTATCAGACCACTTTAATTGG
CGGAGATACTACTCGAGGCCCTCTTGCATTGACGATTACCGCACAAGGGC
TCTTGCCAAAATTAGATGCATTATTACGTCAGAATGCGAAAGAAGGCGAT
TGGATTTTTGTTTCTGGCACCATAGGAGATAGCGCAGCTGGTTTGGCTTT
ATTATTAGATGGTCGTAAAATTTTAGAAGATGATGACCGCTATTTAGTGC
AACGTCATTTACGCCCAACGCCACGTGTTGAGCTTGGTTTAGCATTACGA
TCTTTTTCGCGTTGTGCGATTGATATTTCAGATGGTTTGTTAGCAGATTT
GAACCATATTCTTGAATCTAGTCAAGTGGGTGCAGAAATTTATCTAGAGC
ATTTGCCACTTTCAACGCCGTTACTTAATCGCAATAATCGTGAACAAGCA
GAACAATTTGCGCTGACTGGTGGGGAAGATTATGAACTTTGTTTTACGGT
AGCAGATGATAAGCGGGCGGAAATGGAGCAAGTTTTACATTCACAAGGTA
TGAAGGTTACTTGTATTGGTAAGATTGTTGCGGTTAAAAATGGAATGCAA
TTGTTTAAATATGGACAGCCTGTTGCTTTTCCTACTCAAATAGGTTTTGA
TCATTTCAATGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy