Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR305 IGR303 IGR299 IGR304 IGR300 IGR301 IGR298 IGR302 IGR297 HD0425 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 ponA,mrcA, - HD0426 HD0421 HD0428 HD0430 HD0433 comA, - HD0427 HD0432 pgi, - HD0418 HD0425 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 ponA,mrcA, - HD0426 HD0421 HD0428 HD0430 HD0433 comA, - HD0427 HD0432 pgi, - HD0418 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 ponA,mrcA, - HD0426 HD0424 HD0425 HD0424 HD0421 comA, - HD0427 pgi, - HD0418 HD0429 HD0431 HD0432 HD0430 HD0433 HD0428 HD0431 HD0429
* Calculated from Protein Sequence

Gene ID: HD0423

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aroK  aroL  aroE  

Definition:
shikimate kinase (shikimic acid kinase I)

Gene Start:
336120

Gene Stop:
335596

Gene Length:
525

Molecular Weight*:
19511

pI*:
4.90

Net Charge*:
-4.75

EC:
2.7.1.71  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Parish T, Stoker NG.
The common aromatic amino acid biosynthesis pathway is essential in Mycobacterium tuberculosis.
Microbiology. 2002 Oct;148(Pt 10):3069-77.
PMID: 12368440

Filgueira de Azevedo W Jr, Canduri F, Simoes de Oliveira J, Basso LA, Palma MS, Pereira JH, Santos DS.
Molecular model of shikimate kinase from Mycobacterium tuberculosis.
Biochem Biophys Res Commun. 2002 Jul 5;295(1):142-8.
PMID: 12083781

Gu Y, Reshetnikova L, Li Y, Wu Y, Yan H, Singh S, Ji X.
Crystal structure of shikimate kinase from Mycobacterium tuberculosis reveals the dynamic role of the LID domain in catalysis.
J Mol Biol. 2002 Jun 7;319(3):779-89.
PMID: 12054870

Romanowski MJ, Burley SK.
Crystal structure of the Escherichia coli shikimate kinase I (AroK) that confers sensitivity to mecillinam.
Proteins. 2002 Jun 1;47(4):558-62. No abstract available.
PMID: 12001235

Comment:
For other "aro" genes, see HD1274 (aroC), HD1383 (aroA), HD1475 (aroG), HD0415 (aroE), HD0422 (aroB), HD0444 (aroF), HD0632 (aroQ).

Blast Summary:  PSI-Blast Search
Residues 1 to 173 are 81% ( EScore : 7e-75 ) identical to sp|P43880|AROK_HAEIN SHIKIMATE KINASE between residues 1 and 173 in [Haemophilus influenzae Rd]
Residues 1 to 171 are 74% ( EScore : 3e-70 ) identical to gb|AAF95770.1| (AE004329) shikimate kinase between residues 1 and 170 in [Vibrio cholerae]
Residues 1 to 172 are 71% ( EScore : 7e-67 ) identical to pir||A65134 shikimate kinase between residues 68 and 239 in [Escherichia coli]
Residues 1 to 172 are 71% ( EScore : 7e-67 ) identical to sp|P24167|AROK_ECOLI SHIKIMATE KINASE I between residues 1 and 172 in [Escherichia coli]
Residues 1 to 105 are 70% ( EScore : 3e-36 ) identical to pir||A41967 shikimate kinase between residues 29 and 132 in [Escherichia coli]
Residues 6 to 167 are 40% ( EScore : 6e-32 ) identical to gb|AAF84144.1|AE003966_5 shikimate kinase between residues 6 and 166 in [Xylella fastidiosa]
Residues 7 to 154 are 45% ( EScore : 5e-29 ) identical to gb|AAF42148.1| (AE002531) shikimate kinase [Neisseria meningitidis MC58] >7379379|emb|CAB83937.1| between residues 8 and 154 in [Neisseria meningitidis]
Residues 7 to 171 are 36% ( EScore : 3e-24 ) identical to sp|Q9X5D1|AROK_CORGL SHIKIMATE KINASE between residues 6 and 167 in [Corynebacterium glutamicum]
Residues 9 to 167 are 38% ( EScore : 9e-22 ) identical to sp|P95014|AROK_MYCTU SHIKIMATE KINASE between residues 7 and 163 in [Mycobacterium tuberculosis]
Residues 6 to 173 are 38% ( EScore : 2e-21 ) identical to sp|P72796|AROK_SYNY3 SHIKIMATE KINASE between residues 14 and 179 in [Synechocystis sp.]

COGS Summary:  COGS Search
BeTs to 9 clades of COG0703
COG name: Shikimate kinase
Functional Class:  E
The phylogenetic pattern of COG0703 is ----yqvcEBrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000623 (Shikimate kinase) with a combined E-value of 1.7e-43.
    IPB000623A    7-36
    IPB000623B    55-70
    IPB000623C    78-92
    IPB000623D    119-125
    IPB000623E    136-146
***** IPB003136 (Cytidylate kinase) with a combined E-value of 4.1e-07.
    IPB003136A    7-40


ProDom Summary:  Protein Domain Search
Residues 5-152 are 85% similar to a (KINASE SHIKIMATE TRANSFERASE ACID) protein domain (PD004326) which is seen in AROK_HAEIN.



Paralogs:  Local Blast Search
HD0423 is paralogously related to HD0218 (1e-04).


Pfam Summary:  Pfam Search
Residues 5 to 171 (E-value = 5.2e-78) place HD0423 in the SKI family which is described as Shikimate kinase (PF01202)

PDB Hit:
pdb|1SHK|A Chain A, The Three-Dimensional Structure Of Shikimat... 97 2e-021
pdb|2SHK|B Chain B, The Three-Dimensional Structure Of Shikimat... 96 3e-021
pdb|1SHK|B Chain B, The Three-Dimensional Structure Of Shikimat... 95 5e-021

Gene Protein Sequence:
MAEKRNIFLVGPMGAGKSTIGRQLAQMLNMDFIDSDAVIEERAGASIDWI
FDIEGEAGFRKREERIINELTKGQQGIVLSTGGGSILSKENRNALSARGI
VIYLETTVDKQFERTQRDKKRPLLQTEDPRKILEAIAKERNPLYEEIADI
TLQTDEQSAKVVATHIIELIDNLQ$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTGAAAAACGTAATATTTTCTTAGTTGGCCCTATGGGGGCAGGCAA
AAGCACTATTGGTCGTCAGCTTGCTCAGATGTTAAACATGGATTTCATTG
ACTCCGATGCAGTTATTGAAGAACGTGCTGGTGCAAGCATTGATTGGATC
TTTGATATTGAAGGTGAAGCGGGTTTCCGTAAACGTGAAGAACGTATTAT
TAATGAATTAACTAAAGGTCAACAAGGTATTGTGCTTTCTACCGGTGGTG
GATCTATTTTATCCAAAGAGAATCGCAATGCTTTGTCGGCACGTGGGATT
GTTATCTACTTAGAAACAACAGTAGATAAACAGTTTGAGCGTACACAACG
AGATAAAAAACGTCCGCTCTTACAAACAGAAGATCCGCGTAAAATATTAG
AAGCTATCGCGAAAGAACGTAACCCACTTTATGAAGAAATCGCAGATATT
ACCCTCCAAACTGACGAACAAAGTGCTAAAGTCGTAGCTACGCATATCAT
TGAGTTAATTGATAATTTACAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy