Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-1 IGR303 IGR296 IGR299 IGR304 IGR300 IGR301 IGR298 IGR302 IGR297 IGR295 HD0425 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 ponA,mrcA, - HD0426 HD0421 HD0428 HD0430 HD0417 comA, - HD0427 pgi, - HD0418 HD0425 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 ponA,mrcA, - HD0426 HD0421 HD0428 HD0430 HD0417 comA, - HD0427 pgi, - HD0418 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 ponA,mrcA, - HD0426 HD0424 HD0425 HD0424 HD0421 HD0417 comA, - HD0427 pgi, - HD0418 HD0429 HD0430 HD0428 HD0429
* Calculated from Protein Sequence

Gene ID: HD0422

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aroB  

Definition:
3-dehydroquinate synthase

Gene Start:
335585

Gene Stop:
334497

Gene Length:
1089

Molecular Weight*:
39868

pI*:
6.10

Net Charge*:
-6.81

EC:
4.6.1.3  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Barker JL, Frost JW.
Microbial synthesis of p-hydroxybenzoic acid from glucose.
Biotechnol Bioeng. 2001 Dec;76(4):376-90.
PMID: 11745165

Skinner MA, Gunel-Ozcan A, Shafiq M, Maskell DJ, Brown KA.
Expression of recombinant aroB-encoded dehydroquinate synthase from pathogenic microorganisms.
Biochem Soc Trans. 1998 Aug;26(3):S280. No abstract available.
PMID: 9765999

Comment:
For other "aro" genes, see HD1274 (aroC), HD1383 (aroA), HD1475 (aroG), HD0415 (aroE), HD0423 (aroK), HD0444 (aroF), HD0632 (aroQ).

Blast Summary:  PSI-Blast Search
Residues 10 to 370 are 67% ( EScore : 1e-139 ) identical to sp|P43879|AROB_HAEIN 3-DEHYDROQUINATE SYNTHASE >1073786|pir||G64054 3-dehydroquinate synthase between residues 1 and 360 in [Haemophilus influenzae Rd]
Residues 10 to 365 are 56% ( EScore : 1e-116 ) identical to sp|P07639|AROB_ECOLI 3-DEHYDROQUINATE SYNTHASE >68385|pir||SYECQ 3-dehydroquinate synthase between residues 1 and 356 in [Escherichia coli]
Residues 10 to 365 are 57% ( EScore : 1e-116 ) identical to sp|P77980|AROB_SALTY 3-DEHYDROQUINATE SYNTHASE >1619336|emb|CAA69932.1| between residues 1 and 356 in [Salmonella typhimurium]
Residues 10 to 366 are 53% ( EScore : 1e-105 ) identical to gb|AAF95769.1| (AE004329) 3-dehydroquinate synthase between residues 6 and 361 in [Vibrio cholerae]
Residues 10 to 362 are 54% ( EScore : 1e-101 ) identical to gb|AAF42149.1| (AE002531) 3-dehydroquinate synthase between residues 1 and 351 in [Neisseria meningitidis MC58]
Residues 10 to 362 are 53% ( EScore : 1e-100 ) identical to emb|CAB83936.1| (AL162753) 3-dehydroquinate synthase between residues 1 and 351 in [Neisseria meningitidis]
Residues 10 to 362 are 53% ( EScore : 2e-99 ) identical to sp|O50468|AROB_NEIGO 3-DEHYDROQUINATE SYNTHASE >2661441|emb|CAA05722.1| between residues 1 and 351 in [Neisseria gonorrhoeae]
Residues 13 to 361 are 44% ( EScore : 3e-77 ) identical to sp|P73997|AROB_SYNY3 3-DEHYDROQUINATE SYNTHASE >7428410|pir||S75507 3-dehydroquinate synthase - Synechocystis sp. between residues 5 and 356 in [Synechocystis sp.]
Residues 22 to 362 are 45% ( EScore : 6e-73 ) identical to gb|AAF84143.1|AE003966_4 3-dehydroquinate synthase between residues 18 and 368 in [Xylella fastidiosa]
Residues 10 to 368 are 36% ( EScore : 2e-58 ) identical to sp|P56081|AROB_HELPY 3-DEHYDROQUINATE SYNTHASE >7437193|pir||C64555 3-dehydroquinate synthase - Helicobacter pylori between residues 1 and 342 in [Helicobacter pylori 26695]

COGS Summary:  COGS Search
BeTs to 8 clades of COG0337
COG name: 3-dehydroquinate synthetase
Functional Class:  E
The phylogenetic pattern of COG0337 is ----y-vcebrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 17-356 are 69% similar to a (SYNTHASE 3-DEHYDROQUINATE DEHYDROGENASE LYASE PROTEOME) protein domain (PD002227) which is seen in AROB_PASMU.



Paralogs:  Local Blast Search
HD0422 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 16 to 357 (E-value = 3.5e-183) place HD0422 in the DHQ_synthase family which is described as 3-dehydroquinate synthase (PF01761)

PDB Hit:
pdb|1DQS|B Chain B, Crystal Structure Of Dehydroquinate Synthas... 194 1e-050

Gene Protein Sequence:
MLQVNVELKHHHYPIKIGQGLLTNPQSYAPLKAGDNVMIVSNPTIAQYYL
ATVRDTLITIGCKVDTVLLADGEQYKTFESLNQIFTALLENDHHRDTTLV
ALGGGVIGDVTGYAAASYQRGVRFIQIPTTLLAQIDSSIGGKTAINHPLG
KNMIGAFYQPAAVIIDTQVLNTLAKRQVSAGLAEVIKYGVAFDSHFFEWL
EQHIDQLMQLDPETLAHCIQRCCQLKAAIVAQDETEQGERALLNFGHTFG
HSIEAHLGYGTWLHGESVAVGMLEAAELSKILGNLTEDQLARLEKLLANA
VLPTTSPDGMTADQYLPYMWRDKKVLNGQLRLVLLKSFGQAYITTEATEQ
QILTAIQRFTQH$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTGCAAGTTAATGTTGAATTAAAACATCATCATTACCCCATTAAGAT
TGGTCAGGGATTACTTACCAATCCTCAAAGTTATGCACCCCTAAAAGCTG
GTGATAATGTGATGATTGTTTCTAACCCAACTATAGCACAATATTATCTT
GCTACAGTCCGTGACACGCTCATCACAATAGGTTGTAAAGTTGATACAGT
CTTACTCGCTGATGGTGAGCAATACAAAACATTTGAATCGTTAAACCAAA
TTTTTACCGCTTTATTGGAAAATGATCATCATCGCGATACTACATTAGTC
GCACTCGGCGGTGGTGTAATTGGTGATGTGACCGGTTATGCGGCTGCGTC
GTATCAACGCGGTGTTCGTTTTATACAGATCCCCACCACTTTATTAGCAC
AAATTGATTCATCTATTGGTGGTAAAACTGCGATTAATCACCCATTAGGC
AAAAATATGATTGGTGCTTTTTATCAACCTGCTGCCGTGATTATTGATAC
ACAAGTACTAAATACACTGGCAAAACGCCAAGTCAGCGCTGGACTGGCAG
AAGTGATAAAATACGGCGTTGCTTTTGATAGCCACTTTTTTGAATGGCTA
GAACAACATATTGATCAATTAATGCAATTAGATCCAGAAACATTAGCGCA
TTGTATCCAACGCTGTTGTCAATTAAAAGCGGCGATCGTTGCACAAGATG
AAACTGAACAAGGTGAACGCGCGCTTCTCAACTTTGGGCATACTTTCGGC
CACTCAATTGAAGCACATTTAGGTTATGGCACTTGGTTACACGGTGAAAG
TGTTGCTGTTGGTATGCTAGAAGCGGCCGAATTATCAAAAATATTAGGCA
ATTTAACGGAAGATCAGCTCGCTCGGCTAGAAAAATTGTTAGCCAACGCT
GTTCTGCCCACAACCTCTCCCGATGGAATGACCGCTGATCAATACTTACC
TTATATGTGGCGAGATAAAAAAGTATTAAACGGACAATTACGCCTTGTTC
TTCTAAAATCATTTGGTCAAGCTTATATAACAACTGAAGCAACAGAACAA
CAAATTCTGACAGCGATTCAACGCTTTACACAACACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy