Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-1 tRNA-Met-1 tRNA-Leu-1 IGR296 IGR299 IGR300 IGR301 IGR298 IGR302 IGR297 IGR295 HD0425 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 ponA,mrcA, - HD0426 HD0421 HD0417 comA, - HD0427 aroE,aroD, - HD0415 pgi, - HD0418 HD0425 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 ponA,mrcA, - HD0426 HD0421 HD0417 comA, - HD0427 aroE,aroD, - HD0415 pgi, - HD0418 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 ponA,mrcA, - HD0426 HD0424 HD0425 HD0424 HD0421 HD0417 aroE,aroD, - HD0415 pgi, - HD0418
* Calculated from Protein Sequence

Gene ID: HD0420

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
dam  

Definition:
DNA adenine methylase

Gene Start:
334490

Gene Stop:
333654

Gene Length:
837

Molecular Weight*:
32482

pI*:
10.40

Net Charge*:
16.73

EC:
2.1.1.72  

Functional Class:
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
Brooks,J.E., Blumenthal,R.M. and Gingeras,T.R.
The isolation and characterization of the Escherichia coli DNA
adenine methylase (dam) gene
Nucleic Acids Res. 11 (3), 837-851 (1983)
Medline: 83168905

Lyngstadaas,A., Lobner-Olesen,A. and Boye,E.
Characterization of three genes in the dam-containing operon of
Escherichia coli
Mol. Gen. Genet. 247 (5), 546-554 (1995)
Medline: 95327050

Jonczyk,P., Hines,R. and Smith,D.W.
The Escherichia coli dam gene is expressed as a distal gene of a
new operon
Mol. Gen. Genet. 217 (1), 85-96 (1989)
Medline: 89364696

Guyot,J.B., Grassi,J., Hahn,U. and Guschlbauer,W.
The role of the preserved sequences of Dam methylase
Nucleic Acids Res. 21 (14), 3183-3190 (1993)
Medline: 93341922


Comment:
From Genbank:[gi:1169355]
This enzyme methylates DNA within the sequence GATC. It is directly involved in methyl-directed DNA mismatch repair.



Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to DNA adenine methylases.Residues 6-277 are 58% similar to this enzyme from Haemophilus influenzae Rd (1169355|) and are 52% similar to this enzyme from E.coli (118682|).

COGS Summary:  COGS Search
BeTs to 5 clades of COG0338
COG name: Site-specific DNA methylase dam
Functional Class: L
The phylogenetic pattern of COG0338 is -m-k---Ce--huj---l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00505 (D12 class N6 adenine-specific DNA methyltransferase signature) with a combined E-value of 1.1e-23.
    PR00505A    11-27
    PR00505B    36-50
    PR00505C    55-68
    PR00505D    184-196


ProDom Summary:  Protein Domain Search
Residues 6-64 are 72% similar to a (DNA METHYLTRANSFERASE METHYLASE ADENINE) protein domain (PD342223) which is seen in DMA_SERMA.

Residues 71-260 are 57% similar to a (METHYLTRANSFERASE DNA METHYLASE ADENINE) protein domain (PD002915) which is seen in DMA_HAEIN.



Paralogs:  Local Blast Search


HD0420 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 11 to 260 (E-value = 1.1e-80) place HD0420 in the MethyltransfD12 family which is described as D12 class N6 adenine-specific DNA methyltransferase (PF02086)

PDB Hit:
pdb|2DPM|A Chain A, Dpnm Dna Adenine Methyltransferase From Str... 135 7e-033

Gene Protein Sequence:
MNNNQRAFLKWAGGKYRLSIEIRKFLPPQSTQGVCFVEPFVGAGSVFLNT
HYDRYLLADINSDLINLFNTIKQDVERYITQSKLIFLSPNANTALYYYAK
RQEFNHSTDIFHRSVLFLYLNRFGFNGLCRYNKKNEYNVPFGRYKKPYFP
EKELRFFAAKAQKAQFICADFEHIFEYIYQNPDNYIVYCDPPYAPLEQES
NFTHYASGGFSLAQQELLVKHAKQAQQKQIPVLISNHDTAFTRKIYHGAQ
IKKIKVQRSIGKNAKSRIKVNELLALFS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAACAATAACCAACGTGCTTTTTTAAAATGGGCGGGCGGAAAATACCG
GCTTTCCATAGAAATACGAAAATTCCTACCCCCTCAGTCAACTCAAGGGG
TTTGTTTCGTTGAACCTTTTGTTGGTGCAGGTTCAGTATTTTTAAACACG
CATTATGATCGTTATTTACTCGCAGACATTAACTCTGATCTGATTAATCT
ATTTAACACGATTAAACAAGATGTAGAGCGGTACATTACTCAAAGTAAAC
TCATTTTTCTTTCACCTAATGCCAATACTGCACTATATTATTATGCAAAA
CGTCAAGAATTTAATCATTCTACTGATATTTTTCATCGATCGGTGCTTTT
CCTCTATCTAAATCGCTTTGGTTTTAATGGGCTTTGTCGATACAATAAAA
AAAACGAATATAATGTCCCTTTTGGGCGCTATAAAAAACCTTATTTCCCA
GAAAAGGAATTACGTTTCTTTGCTGCCAAAGCCCAAAAAGCACAATTCAT
TTGTGCTGACTTCGAGCATATATTTGAATATATTTACCAAAACCCTGATA
ATTATATTGTCTATTGCGATCCGCCTTATGCTCCATTGGAACAAGAAAGC
AATTTTACTCACTATGCTAGCGGTGGCTTTAGCCTAGCCCAACAAGAATT
ATTGGTAAAGCATGCAAAGCAAGCACAACAAAAACAAATTCCGGTACTGA
TCTCTAACCATGATACCGCTTTCACACGTAAAATTTATCACGGTGCTCAA
ATAAAAAAAATCAAAGTGCAACGTTCTATTGGCAAAAATGCGAAGTCTCG
GATCAAAGTGAACGAACTTTTAGCACTTTTTAGCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy