Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-1 tRNA-Met-1 tRNA-Leu-1 IGR296 IGR299 IGR300 IGR298 IGR294 IGR297 IGR295 HD0425 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 HD0421 HD0417 recX, - HD0411 HD0414 aroE,aroD, - HD0415 recA, - HD0410 pgi, - HD0418 HD0425 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 HD0421 HD0417 recX, - HD0411 HD0414 aroE,aroD, - HD0415 recA, - HD0410 pgi, - HD0418 aroK,aroL,aroE, - HD0423 dam, - HD0420 aroB, - HD0422 HD0419 HD0424 HD0425 HD0424 HD0421 HD0417 recX, - HD0411 aroE,aroD, - HD0415 recA, - HD0410 pgi, - HD0418 yrdD, - HD0413 yrdD, - HD0413 HD0414 HD0412 HD0412
* Calculated from Protein Sequence

Gene ID: HD0418

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pgi  

Definition:
glucose-6-phosphate isomerase

Gene Start:
330441

Gene Stop:
332114

Gene Length:
1674

Molecular Weight*:
62514

pI*:
6.80

Net Charge*:
-1.97

EC:
5.3.1.9  

Functional Class:
Energy metabolism; Glycolysis and gluconeogenesis  

Pathway: pathway table
Glycolysis / Gluconeogenesis
Pentose phosphate cycle
Starch and sucrose metabolism

Secondary Evidence:
Arsenieva D, Jeffery C.
Conformational changes in phosphoglucose isomerase induced by ligand binding.
J Mol Biol. 2002 Oct 11;323(1):77.
PMID: 12368100



Comment:
0

Blast Summary:  PSI-Blast Search
Residues 3 to 556 are 78% ( EScore : 0.0 ) identical to sp|P44312|G6PI_HAEIN GLUCOSE-6-PHOSPHATE ISOMERASE between residues 7 and 563 in [Haemophilus influenzae Rd]
Residues 11 to 556 are 75% ( EScore : 0.0 ) identical to pir||NUEC glucose-6-phosphate isomerase between residues 1 and 548 in [Escherichia coli]
Residues 11 to 556 are 75% ( EScore : 0.0 ) identical to sp|P11537|G6PI_ECOLI GLUCOSE-6-PHOSPHATE ISOMERASE between residues 1 and 548 in [Escherichia coli]
Residues 11 to 556 are 74% ( EScore : 0.0 ) identical to sp|P11243|G6PI_CLAUN between residues 1 and 548
Residues 11 to 556 are 71% ( EScore : 0.0 ) identical to gb|AAF93547.1| (AE004125) glucose-6-phosphate isomerase between residues 2 and 549 in [Vibrio cholerae]
Residues 23 to 556 are 64% ( EScore : 0.0 ) identical to sp|P52030|G6PI_DROSI GLUCOSE-6-PHOSPHATE ISOMERASE between residues 18 and 558 in [Drosophila simulans]
Residues 23 to 556 are 64% ( EScore : 0.0 ) identical to sp|P52031|G6PI_DROYA GLUCOSE-6-PHOSPHATE ISOMERASE between residues 18 and 558 in [Drosophila yakuba]
Residues 23 to 556 are 64% ( EScore : 0.0 ) identical to gb|AAA28809.1| (L27679) glucose-6-phosphate isomerase between residues 18 and 558 in [Drosophila yakuba]
Residues 23 to 556 are 64% ( EScore : 0.0 ) identical to gb|AAA28789.1| (L27539) glucosephosphate isomerase [Drosophila melanogaster] >443601|gb|AAA28791.1| between residues 18 and 558 in [Drosophila melanogaster]
Residues 23 to 556 are 64% ( EScore : 0.0 ) identical to gb|AAA28797.1| (L27547) glucosephosphate isomerase [Drosophila simulans] >443615|gb|AAA28798.1| between residues 18 and 558 in [Drosophila simulans]

COGS Summary:  COGS Search
BeTs to 12 clades of COG0166
COG name: Glucose-6-phosphate isomerase
Functional Class:  G
The phylogenetic pattern of COG0166 is -m--yqvcebrhujgpolin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001672 (Phosphoglucose isomerase (PGI)) with a combined E-value of 2.1e-213.
    IPB001672A    90-110
    IPB001672B    142-178
    IPB001672C    191-233
    IPB001672D    247-282
    IPB001672E    327-373
    IPB001672F    385-403
    IPB001672G    424-447
    IPB001672H    490-522


ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search

HD0418 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1DQR|A Chain A, Crystal Structure Of Rabbit Phosphoglucose ... 695 0.0
pdb|1C7Q|A Chain A, The Crystal Structure Of Phosphoglucose Iso... 68 2e-012

Gene Protein Sequence:
LTLIIKRSLKMRNINPTDTMAWQALVQHKAEHLSIPQLFAENEDRFATYN
LSFEDQILVDYSKNAINQKTLTLLRQLAKECDVDGARQAMFSGEKINRTE
NRAVLHIALRNRANKAIFVDGKDVMPAVNAVLAKMKAFSEKVIKGDWKGY
TGKAITDVINIGIGGSDLGPYMVTEALRPYKNHLNMHFVSNVDGTHIAEV
LRKVNPETTLVLVASKTFTTQETMTNAFSAREWLLADAKDQSAVAKHFVA
LSTNSETVAKFGIDTENMFEFWDWVGGRYSLWSAIGLSIVLSIGFANFEQ
LLEGAYAMDKHFYHTADEQNIPLTLALVSIWNNNFLGAQTEAILPYDQYL
HRFAAYFQQGNMESNGKYIGRDGKAVNYQTGPIIWGEPGTNGQHAFYQLI
HQGTTLIPCDFIAPAQTHNPLSDHHNKLLSNFFAQTEALAFGKSKAQVEL
EFTQQGKSLDEVKDIVPFKVFTGNKPTNSILLKKVTPYSLGALIAMYEHK
IFVQGVLFNIYSFDQWGVELGKQLANRILPELEDDQPVVSHDSSTNGLIN
QFKAWRE$

Gene Nucleotide Sequence:  Sequence Viewer
TTGACGTTAATCATTAAAAGGAGCTTGAAAATGCGAAATATTAATCCAAC
AGATACAATGGCTTGGCAAGCATTAGTTCAACATAAAGCTGAGCATCTTA
GTATTCCTCAGCTTTTTGCAGAAAATGAAGATCGTTTTGCTACATATAAT
TTATCTTTTGAAGATCAAATTTTAGTTGATTATTCAAAGAATGCGATTAA
TCAAAAAACATTAACTTTGCTACGTCAATTAGCGAAAGAATGTGATGTTG
ATGGCGCACGTCAAGCAATGTTTTCTGGTGAGAAGATCAACCGGACAGAA
AATAGGGCTGTTTTGCATATTGCGTTGCGTAATCGTGCAAATAAAGCTAT
TTTCGTTGATGGCAAGGATGTGATGCCAGCAGTCAATGCAGTATTAGCTA
AGATGAAAGCGTTTAGTGAAAAGGTGATTAAGGGTGATTGGAAAGGCTAT
ACGGGTAAAGCAATTACGGATGTAATTAATATTGGTATCGGTGGATCTGA
TTTAGGGCCTTATATGGTGACGGAAGCATTACGGCCTTATAAGAATCATT
TAAATATGCATTTTGTATCGAATGTAGATGGTACACATATTGCGGAAGTA
TTACGTAAGGTTAATCCAGAAACTACTTTAGTGCTGGTGGCATCTAAAAC
CTTTACCACACAAGAAACAATGACAAATGCTTTTTCTGCACGCGAGTGGC
TGTTAGCGGATGCTAAAGATCAATCAGCAGTGGCGAAACATTTTGTTGCA
TTATCAACCAATAGTGAAACGGTCGCTAAATTTGGAATTGATACAGAGAA
TATGTTTGAATTCTGGGATTGGGTTGGTGGGCGTTATTCATTATGGTCTG
CGATTGGTTTGTCTATCGTCCTTTCTATTGGCTTTGCTAATTTTGAGCAA
TTGCTTGAAGGTGCTTATGCAATGGATAAGCATTTTTATCATACAGCGGA
TGAACAGAATATTCCGCTTACGTTAGCGTTAGTTAGTATTTGGAATAATA
ATTTCTTAGGTGCACAAACGGAAGCAATTTTACCTTATGATCAATATTTA
CATCGTTTTGCGGCTTATTTCCAGCAGGGGAATATGGAATCAAATGGTAA
ATATATTGGGCGAGATGGCAAAGCCGTAAATTATCAAACAGGGCCTATTA
TTTGGGGAGAGCCGGGTACTAATGGTCAACACGCTTTTTATCAGTTGATT
CATCAAGGAACAACATTAATTCCTTGTGATTTTATTGCACCTGCTCAGAC
ACATAATCCATTATCAGATCATCATAATAAGCTATTATCAAACTTTTTTG
CTCAAACAGAGGCATTAGCATTTGGTAAATCAAAAGCGCAAGTAGAATTA
GAATTTACTCAACAAGGTAAATCGCTTGATGAAGTGAAAGATATTGTGCC
ATTTAAGGTATTTACGGGTAATAAGCCGACAAATTCGATTTTATTGAAAA
AAGTGACCCCTTATAGTTTAGGGGCGTTAATTGCTATGTATGAACACAAA
ATTTTTGTGCAAGGTGTGTTATTCAATATCTATAGTTTTGATCAATGGGG
TGTTGAATTAGGCAAACAATTGGCTAATCGTATTTTGCCAGAACTTGAAG
ATGATCAGCCTGTTGTTAGTCATGATAGTTCAACAAATGGCTTGATTAAT
CAATTTAAAGCGTGGCGTGAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy