Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Gln-1 tRNA-Met-1 tRNA-Leu-1 IGR296 IGR298 IGR294 IGR297 IGR293 IGR295 dam, - HD0420 HD0419 HD0417 recX, - HD0411 HD0414 aroE,aroD, - HD0415 pabB,trpE, - HD0408 recA, - HD0410 pgi, - HD0418 dam, - HD0420 HD0419 HD0417 recX, - HD0411 HD0414 aroE,aroD, - HD0415 pabB,trpE, - HD0408 recA, - HD0410 pgi, - HD0418 dam, - HD0420 HD0419 HD0417 recX, - HD0411 aroE,aroD, - HD0415 pabB,trpE, - HD0408 recA, - HD0410 pgi, - HD0418 yrdD, - HD0413 HD0409 yrdD, - HD0413 HD0409 HD0414 HD0412 HD0412
* Calculated from Protein Sequence

Gene ID: HD0415

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
aroE  aroD  

Definition:
shikimate 5-dehydrogenase, aroE

Gene Start:
328785

Gene Stop:
329615

Gene Length:
831

Molecular Weight*:
30588

pI*:
8.80

Net Charge*:
5.01

EC:
1.1.1.25  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis

Secondary Evidence:
Anton,I.A. and Coggins,J.R.
Sequencing and overexpression of the Escherichia coli aroE gene
encoding shikimate dehydrogenase
Biochem. J. 249 (2), 319-326 (1988)
MEDLINE: 88134021

Maclean,J., Campbell,S.A., Pollock,K., Chackrewarthy,S.,
Coggins,J.R. and Lapthorn,A.J.
Crystallization and preliminary X-ray analysis of shikimate
dehydrogenase from Escherichia coli
Acta Crystallogr. D 56, 512-515 (2000)

Comment:
For other "aro" genes, see HD1274 (aroC), HD1383 (aroA), HD1475 (aroG), HD0422 (aroB), HD0423 (aroK), HD0444 (aroF), HD0632 (aroQ).

Blast Summary:  PSI-Blast Search
Residues 5 to 272 are 56% ( EScore : 5e-77 ) identical to sp|P43876|AROE_HAEIN SHIKIMATE 5-DEHYDROGENASE >1075302|pir||H64084 shikimate 5-dehydrogenase homolog between residues 4 and 271 in [Haemophilus influenzae Rd]
Residues 5 to 272 are 52% ( EScore : 2e-65 ) identical to sp|P15770|AROE_ECOLI SHIKIMATE 5-DEHYDROGENASE >78850|pir||S00252 shikimate 5-dehydrogenase between residues 4 and 270 in [Escherichia coli]
Residues 4 to 272 are 43% ( EScore : 1e-55 ) identical to gb|AAF93234.1| (AE004096) shikimate 5-dehydrogenase between residues 7 and 274 in [Vibrio cholerae]
Residues 4 to 269 are 45% ( EScore : 7e-51 ) identical to sp|P95400|AROE_NEIPH SHIKIMATE 5-DEHYDROGENASE >1785904|gb|AAC44917.1| between residues 6 and 267 in [Neisseria pharyngis var. flava]
Residues 4 to 269 are 44% ( EScore : 4e-50 ) identical to sp|P95389|AROE_NEIMU SHIKIMATE 5-DEHYDROGENASE >1785908|gb|AAC44919.1| between residues 6 and 267 in [Neisseria mucosa]
Residues 4 to 270 are 43% ( EScore : 6e-50 ) identical to gb|AAC44911.1| (U82840) shikimate dehydrogenase [Neisseria meningitidis] >7225580|gb|AAF40801.1| between residues 6 and 268 in [Neisseria meningitidis MC58]
Residues 4 to 270 are 42% ( EScore : 6e-50 ) identical to sp|P95368|AROE_NEILA SHIKIMATE 5-DEHYDROGENASE >1785898|gb|AAC44914.1| between residues 6 and 268 in [Neisseria lactamica]
Residues 4 to 270 are 43% ( EScore : 6e-50 ) identical to emb|CAB85341.1| (AL162758) shikimate dehydrogenase between residues 8 and 270 in [Neisseria meningitidis]
Residues 4 to 275 are 44% ( EScore : 8e-50 ) identical to sp|P43904|AROE_PSEAE SHIKIMATE 5-DEHYDROGENASE >747873|emb|CAA59377.1| between residues 3 and 274 in [Pseudomonas aeruginosa]
Residues 4 to 270 are 43% ( EScore : 4e-49 ) identical to gb|AAC44906.1| (U82835) shikimate dehydrogenase between residues 6 and 268 in [Neisseria meningitidis]

COGS Summary:  COGS Search
BeTs to 12 clades of COG0169
COG name: Shikimate 5-dehydrogenase
Functional Class:  E
The phylogenetic pattern of COG0169 is amt-yqvcEbrHuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002907 (Shikimate / quinate 5-dehydrogenase) with a combined E-value of 5e-46.
    IPB002907A    7-34
    IPB002907B    58-89
    IPB002907C    97-106
    IPB002907D    124-133
    IPB002907E    181-194
    IPB002907F    239-254


ProDom Summary:  Protein Domain Search
Residues 123-191 are 70% similar to a (BIOSYNTHESIS OXIDOREDUCTASE NADP GLUTAMYL-TRNA 1.2.1.-) protein domain (PD001191) which is seen in AROE_PASMU.

Residues 4-113 are 64% similar to a (SHIKIMATE 5-DEHYDROGENASE OXIDOREDUCTASE BIOSYNTHESIS) protein domain (PD120824) which is seen in AROE_PASMU.

Residues 123-191 are 50% similar to a (SHIKIMATE 5-DEHYDROGENASE AMINO NADP) protein domain (PD392460) which is seen in AROE_BUCAP.



Paralogs:  Local Blast Search
HD0415 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 20 to 257 (E-value = 1.5e-64) place HD0415 in the Shikimate_DH family which is described as Shikimate / quinate 5-dehydrogenase (PF01488)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MARQYAVWGNPIAHSKSPYIHQLFAQQSNRRIEYAAKLGDKIAFEKQLVQ
FFTDGANGVNITSPFKARAFRLADVCSESCLLAGAANTLKRLDDGRLFAD
NTDGKGFCADLARLEWLIPEQRVLILGAGGVTKGVLLPLLLAKQKVTLSN
RTHIKAVELAQQFAKYGDIQAVSLSEIVQHPPFDLIINATSLGLQGGYIA
LPNHLFEKSAVYDMEYASNMCTPFLNYVRTQGVTRYQDGLGMLVNQAAFS
FQLWEGELPKVENVLKQLRAEMGYVK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCACGTCAATATGCAGTGTGGGGTAATCCTATTGCGCATAGTAAATC
TCCATATATTCATCAGTTATTCGCTCAACAGTCAAATCGGCGTATTGAAT
ATGCCGCGAAATTAGGGGATAAAATTGCGTTTGAAAAGCAACTTGTACAA
TTTTTTACTGATGGTGCAAATGGTGTAAATATTACTTCACCATTTAAAGC
GCGCGCGTTCAGATTAGCGGATGTATGCAGTGAAAGTTGCTTATTAGCAG
GCGCGGCTAATACACTGAAGCGTTTAGATGATGGGCGTTTGTTTGCAGAT
AATACAGATGGCAAAGGGTTTTGTGCCGATTTAGCGCGATTAGAGTGGCT
GATTCCTGAACAGCGGGTGCTAATTTTAGGCGCGGGGGGCGTCACTAAAG
GTGTGTTACTTCCCTTATTGTTAGCTAAGCAGAAGGTTACTTTATCTAAC
CGCACACACATTAAAGCAGTTGAATTAGCTCAGCAATTTGCTAAATATGG
CGATATTCAAGCGGTCTCTCTATCTGAAATTGTTCAGCATCCACCATTTG
ACTTAATTATTAATGCAACATCTTTAGGCCTACAAGGCGGATATATAGCT
TTGCCTAATCATTTATTTGAGAAGAGTGCTGTCTATGATATGGAATATGC
TAGCAATATGTGTACTCCATTTTTAAATTATGTTCGTACACAAGGCGTTA
CACGTTATCAAGATGGTTTAGGTATGTTAGTAAATCAAGCTGCTTTTTCT
TTTCAATTATGGGAAGGGGAATTGCCAAAGGTGGAAAATGTACTTAAACA
ACTGAGAGCAGAAATGGGTTATGTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy