Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR290 IGR289 IGR291 IGR294 IGR292 IGR293 HD0405 HD0407 recX, - HD0411 HD0414 rnfE, - HD0403 aroE,aroD, - HD0415 msbB,htrB,waaN, - HD0404 pabB,trpE, - HD0408 recA, - HD0410 HD0405 HD0407 recX, - HD0411 HD0414 rnfE, - HD0403 aroE,aroD, - HD0415 msbB,htrB,waaN, - HD0404 pabB,trpE, - HD0408 recA, - HD0410 HD0407 trpG,trpD,pabA, - HD0406 trpG,trpD,pabA, - HD0406 HD0405 recX, - HD0411 rnfE, - HD0403 aroE,aroD, - HD0415 msbB,htrB,waaN, - HD0404 pabB,trpE, - HD0408 recA, - HD0410 yrdD, - HD0413 HD0409 yrdD, - HD0413 HD0409 HD0414 HD0412 HD0412
* Calculated from Protein Sequence

Gene ID: HD0408

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pabB  trpE  

Definition:
para-aminobenzoate synthase component I/possible anthranilate synthase component I

Gene Start:
324055

Gene Stop:
325056

Gene Length:
1002

Molecular Weight*:
37791

pI*:
5.50

Net Charge*:
-2.70

EC:
4.1.3.-  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table

Secondary Evidence:
Rayl EA, Green JM, Nichols BP.
Escherichia coli aminodeoxychorismate synthase: analysis of pabB mutations affecting catalysis and subunit association.
Biochim Biophys Acta. 1996 Jun 7;1295(1):81-8.
PMID: 8679677

Comment:
Anthranilate synthase can be associated with pabA; in this case it may be associated with pabB and/or pabB may also serve as pabA, however see HD0406.

Blast Summary:  PSI-Blast Search
Residues 11-330 are 59% similar to >15603329 PabB [Pasteurella multocida]. Residues 9-330 are 56% similar to >23467790 hypothetical protein [Haemophilus somnus 129PT]. Residues 10-330 are 57% similar to 1075102 p-aminobenzoate synthase component I homolog - Haemophilus influenzae (strain Rd KW20).

COGS Summary:  COGS Search
BeTs to 11 clades of COG0147
COG name: Anthranilate/para-aminobenzoate synthases component II
Functional Class: E,H
The phylogenetic pattern of COG0147 is amt-YQvCEBRHUJ-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00095 (Anthranilate synthase component I signature) with a combined E-value of 7.3e-10.
    PR00095A    170-183
    PR00095B    184-197
    PR00095C    268-282


ProDom Summary:  Protein Domain Search
Residues 12-134 are 44% similar to a (PROTEOME COMPLETE HI1170 PABB) protein domain (PD127102) which is seen in Q57527_HAEIN.

Residues 135-325 are 67% similar to a (SYNTHASE ANTHRANILATE COMPONENT BIOSYNTHESIS LYASE) protein domain (PD000779) which is seen in Q9CKY6_PASMU.


Paralogs:  Local Blast Search
HD0408 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 80 to 333 (E-value = 3.4e-19) place HD0408 in the Chorismate_bind family which is described as chorismate binding enzyme (PF00425)

PDB Hit:
pdb|1QDL|A Chain A, The Crystal Structure Of Anthranilate Synth... 92 7e-020
pdb|1QDL|A Chain A, The Crystal Structure Of Anthranilate Synth... 317 1e-087

Gene Protein Sequence:
VIKLMPFLANAMQQFIQAANDFGQQKRPFFFLIDFEQQKPIIVPLEQAQV
SGLFFDFTGKTNYQAQPVTEACQFNYQAIPLARYQQDFEFVQQQIQAGNS
YLLNLTYPTTIHTNYDLAQLYSACSAKYKLWFKDQFVCFSPETFVRIYDN
KIYAYPMKGTINADLPNAEQQLMASEKEFTEHNTIVDLIRNDLALVAQNI
QVTKYRYVEKINTYRGAIYQTSSEICGELSAPWQAGVGTLLAKLLPAGSI
SGAPKQKTIAIIRQAELDKRGYYTGIFGYFDGNQLESAVAIRYIEQQGQQ
LIFRSGGGITAKSELTAEYQELLEKVYVPISTV$

Gene Nucleotide Sequence:  Sequence Viewer
GTGATAAAATTAATGCCTTTTTTAGCCAATGCAATGCAACAATTTATTCA
GGCTGCCAATGATTTTGGACAGCAGAAGCGCCCCTTTTTCTTTTTAATTG
ATTTTGAGCAGCAAAAACCAATAATTGTACCGCTTGAGCAAGCACAAGTA
AGCGGGCTATTTTTTGATTTTACTGGAAAAACAAATTACCAAGCCCAGCC
CGTTACAGAGGCTTGTCAATTTAATTATCAGGCTATTCCATTAGCCCGTT
ATCAACAAGACTTTGAGTTCGTACAACAACAGATACAAGCGGGTAATAGT
TATTTATTGAATTTAACTTATCCAACGACCATTCACACAAATTATGATTT
AGCTCAGCTATATTCTGCGTGTTCTGCAAAATATAAATTATGGTTTAAAG
ATCAATTTGTCTGCTTTTCGCCAGAAACTTTTGTACGAATTTACGACAAT
AAAATTTATGCTTATCCAATGAAAGGGACAATTAACGCAGATTTACCCAA
TGCTGAACAGCAATTAATGGCGTCTGAGAAAGAGTTTACCGAACATAATA
CGATTGTTGATTTAATTCGCAATGATTTAGCATTAGTGGCACAAAATATT
CAAGTAACAAAATATCGTTATGTCGAAAAAATTAATACTTATCGAGGCGC
TATTTATCAAACCAGTTCTGAAATTTGTGGTGAATTATCAGCACCGTGGC
AAGCCGGTGTAGGGACCTTATTAGCTAAATTATTGCCAGCAGGATCGATT
AGTGGCGCACCAAAACAAAAAACCATTGCCATTATTCGGCAAGCTGAATT
GGACAAACGAGGTTATTATACGGGGATTTTTGGTTATTTTGATGGTAATC
AGTTAGAAAGTGCAGTGGCGATTCGTTATATCGAACAGCAAGGACAACAA
CTGATTTTTCGTAGTGGTGGCGGTATTACAGCTAAAAGTGAATTAACTGC
TGAATACCAAGAATTGTTAGAGAAAGTATATGTGCCAATTTCCACTGTTT
GA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy