Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR288 IGR290 IGR289 IGR291 IGR294 IGR292 IGR293 HD0405 HD0407 recX, - HD0411 rnfG, - HD0401 rnfE, - HD0403 msbB,htrB,waaN, - HD0404 pabB,trpE, - HD0408 rnfD, - HD0400 recA, - HD0410 rnfC, - HD0398 HD0405 HD0407 recX, - HD0411 rnfG, - HD0401 rnfE, - HD0403 msbB,htrB,waaN, - HD0404 pabB,trpE, - HD0408 rnfD, - HD0400 recA, - HD0410 rnfC, - HD0398 Type: tandem, Name:  - 9 HD0407 trpG,trpD,pabA, - HD0406 trpG,trpD,pabA, - HD0406 HD0405 recX, - HD0411 rnfG, - HD0401 rnfE, - HD0403 msbB,htrB,waaN, - HD0404 pabB,trpE, - HD0408 rnfD, - HD0400 recA, - HD0410 rnfC, - HD0398 HD0409 HD0409
* Calculated from Protein Sequence

Gene ID: HD0406

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
trpG  trpD  pabA  

Definition:
anthranilate synthase component II/possible para-amino benzoate component II

Gene Start:
322341

Gene Stop:
321754

Gene Length:
588

Molecular Weight*:
22072

pI*:
7.60

Net Charge*:
2.01

EC:
4.1.3.27  

Functional Class:
Amino acid biosynthesis; Aromatic amino acid family  
Biosynthesis of cofactors, prosthetic groups, and carriers; Folic acid  

Pathway: pathway table
Phenylalanine, tyrosine and tryptophan biosynthesis
Ubiquinone biosynthesis

Comment:
pabA and pabB may be bifunctional enzymes in so far as they perform trp E and trpD functions (anthranilate synthase components). See HD0408.

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously sequenced 6969436 in GenBank.

Residues 15 to 201 are 59% ( EScore : 9e-65 ) identical to sp|P44339|YB71_HAEIN PUTATIVE ANTHRANILATE SYNTHASE COMPONENT II between residues 2 and 187 in [Haemophilus influenzae Rd]
Residues 15 to 199 are 35% ( EScore : 1e-29 ) identical to emb|CAB73126.1| (AL139076) para-aminobenzoate synthase glutamine amidotransferase component II between residues 3 and 186 in [Campylobacter jejuni]
Residues 16 to 199 are 39% ( EScore : 9e-29 ) identical to dbj|BAA83385.1| (AB030031) anthranilate synthase beta subunit between residues 2 and 185 in [Nitrosomonas europaea]
Residues 15 to 200 are 39% ( EScore : 6e-28 ) identical to pir||C70699 probable pabA protein - Mycobacterium tuberculosis between residues 2 and 190 in [Mycobacterium tuberculosis]
Residues 15 to 200 are 39% ( EScore : 2e-27 ) identical to pir||T10008 probable p-aminobenzoate synthase between residues 2 and 190 in [Mycobacterium leprae]
Residues 15 to 203 are 37% ( EScore : 2e-27 ) identical to pir||E70349 anthranilate synthase component II - Aquifex aeolicus >2983181|gb|AAC06781.1| between residues 2 and 190 in [Aquifex aeolicus]
Residues 16 to 199 are 36% ( EScore : 3e-27 ) identical to emb|CAB74183.1| (AL139075) anthranilate synthase component II between residues 2 and 184 in [Campylobacter jejuni]
Residues 16 to 199 are 38% ( EScore : 3e-27 ) identical to sp|P20576|TRPG_PSEAE ANTHRANILATE SYNTHASE COMPONENT II between residues 2 and 190 in [Pseudomonas aeruginosa]
Residues 16 to 199 are 36% ( EScore : 4e-27 ) identical to sp|P28819|PABA_BACSU PARA-AMINOBENZOATE/ANTHRANILATE SYNTHASE GLUTAMINE AMIDOTRANSFERASE COMPONENT II [INCLUDES: PARA-AMINOBENZOATE SYNTHASE GLUTAMINE AMIDOTRANSFERASE COMPONENT II between residues 2 and 185 in [Bacillus subtilis]

COGS Summary:  COGS Search
BeTs to 11 clades of COG0512
COG name: Anthranilate/para-aminobenzoate synthases component I
Functional Class:  E,H
The phylogenetic pattern of COG0512 is amt-YqvcEbrHuj-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001674 (GMP synthase C terminal domain) with a combined E-value of 1.3e-14.
    IPB001674A    8-34
    IPB001674B    78-87
    IPB001674D    169-190
***** IPB000991 (Glutamine amidotransferase class-I) with a combined E-value of 4.9e-10.
    IPB000991A    78-87
    IPB000991B    168-178


ProDom Summary:  Protein Domain Search
Residues 78-158 are identical to a (TRPG) protein domain (PD391013) which is seen in Q9L7U7_HAEDU.

Residues 159-191 are identical to a (GLUTAMINE SYNTHASE AMIDOTRANSFERASE BIOSYNTHESIS GMP) protein domain (PD348302) which is seen in Q9L7U7_HAEDU.

Residues 7-60 are 68% similar to a (SYNTHASE GLUTAMINE BIOSYNTHESIS II) protein domain (PD233381) which is seen in YB71_HAEIN.

Residues 51-134 are 40% similar to a (GMP GLUTAMINE AMIDOTRANSFERASE) protein domain (PD004928) which is seen in TRPG_METJA.

Residues 79-139 are 67% similar to a (SYNTHASE GLUTAMINE AMIDOTRANSFERASE ANTHRANILATE) protein domain (PD000306) which is seen in YB71_HAEIN.

Residues 8-77 are identical to a (TRPG PROTEOME COMPONENT COMPLETE) protein domain (PD095731) which is seen in Q9L7U7_HAEDU.



Paralogs:  Local Blast Search
HD0406 is paralogously related to HD1504 (1e-07).


Pfam Summary:  Pfam Search
Residues 9 to 193 (E-value = 4.8e-50) place HD0406 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)

PDB Hit:
pdb|1QDL|B Chain B, The Crystal Structure Of Anthranilate Synth... 111 7e-026

Gene Protein Sequence:
MKINQTKLLIIDNHDSFTFNLVDLLRKIKVEMQVVSVEQLDLNHVESFSH
ILISPGPDTPSVYPNTLAMLARFYQHKSILGVCLGHQTLCEFFGGTLYNL
TNVRHGQQRLIQQIAPNPLFDGLPPQFKVGLYHSWAISQISLINTPLIAT
AVCDQNVLMAFKHNALPIYGVQFHPESFLTEFGQRMLSNWLTVSK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAGATCAACCAAACTAAATTACTCATTATTGATAATCACGACTCTTT
TACGTTTAATTTGGTCGATTTACTGCGCAAAATAAAAGTTGAGATGCAAG
TAGTCTCCGTTGAACAATTAGATTTAAACCACGTAGAATCATTTAGCCAT
ATTTTAATTTCACCGGGGCCAGATACGCCTTCTGTATATCCTAATACATT
AGCGATGTTGGCTCGCTTTTATCAACATAAATCTATTTTAGGCGTCTGTT
TGGGCCATCAGACATTATGCGAATTCTTTGGGGGTACACTGTATAATTTG
ACCAATGTTCGACACGGCCAGCAACGATTGATCCAACAAATTGCACCAAA
TCCACTATTTGATGGCTTACCGCCACAATTCAAGGTTGGGCTTTATCATT
CTTGGGCTATTTCGCAAATTTCTCTTATTAATACACCGCTTATCGCAACC
GCTGTCTGTGATCAAAATGTATTAATGGCCTTTAAACATAATGCGTTACC
CATCTATGGCGTGCAATTTCACCCAGAATCTTTTCTTACTGAATTTGGTC
AAAGAATGCTATCGAATTGGCTCACTGTAAGTAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy