Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR288 IGR290 IGR289 IGR291 IGR292 IGR293 HD0405 HD0407 rnfG, - HD0401 rnfE, - HD0403 msbB,htrB,waaN, - HD0404 pabB,trpE, - HD0408 rnfD, - HD0400 rnfC, - HD0398 HD0405 HD0407 rnfG, - HD0401 rnfE, - HD0403 msbB,htrB,waaN, - HD0404 pabB,trpE, - HD0408 rnfD, - HD0400 rnfC, - HD0398 Type: tandem, Name:  - 9 HD0407 trpG,trpD,pabA, - HD0406 trpG,trpD,pabA, - HD0406 HD0405 rnfG, - HD0401 rnfE, - HD0403 msbB,htrB,waaN, - HD0404 pabB,trpE, - HD0408 rnfD, - HD0400 rnfC, - HD0398 HD0409 rnfB, - HD0397 HD0409 rnfB, - HD0397
* Calculated from Protein Sequence

Gene ID: HD0404

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
msbB  htrB  waaN  

Definition:
lipid A acyltransferase

Gene Start:
320251

Gene Stop:
321207

Gene Length:
957

Molecular Weight*:
36786

pI*:
10.50

Net Charge*:
16.83

EC:
2.3.1.-  

Functional Class:
Cellular processes; Chaperones  
Regulatory functions  

Pathway: pathway table
Aminosugars metabolism
Butanoate metabolism
D-Arginine and D-ornithine metabolism
Glycerolipid metabolism
Histidine metabolism
Lipopolysaccharide biosynthesis
Lysine biosynthesis
Lysine degradation
Phenylalanine metabolism
Tyrosine metabolism
Valine, leucine and isoleucine degradation

Secondary Evidence:
D'Hauteville H, Khan S, Maskell DJ, Kussak A, Weintraub A, Mathison J, Ulevitch RJ, Wuscher N, Parsot C, Sansonetti PJ.
Two msbB genes encoding maximal acylation of lipid A are required for invasive Shigella flexneri to mediate inflammatory rupture and destruction of the intestinal epithelium.
J Immunol. 2002 May 15;168(10):5240-51.
PMID: 11994481

Murray SR, Bermudes D, de Felipe KS, Low KB.
Extragenic suppressors of growth defects in msbB Salmonella.
J Bacteriol. 2001 Oct;183(19):5554-61.
PMID: 11544217

Somerville JE Jr, Cassiano L, Darveau RP.
Escherichia coli msbB gene as a virulence factor and a
therapeutic target.
Infect Immun. 1999 Dec;67(12):6583-90.
PMID: 10569778

Comment:


Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported 6969434 in GenBank.

Numerous significant hits in gapped BLAST to lipid A acyltransferase; e.g., residues 3-315 are 61% similar to MSBB_HAEIN [1171030], residues 1-317 are 36% similar to MSBB_ECOLI [127340], and residues 1-317 are 36% similar to the sequence for lipid A acyltransferase in Salmonella typhimurium [4104731].

COGS Summary:  COGS Search
BeTs to 3 clades of COG1560
COG name: Lauroyl/myristoyl acyltransferase involved in lipid A biosynthesis
Functional Class: N
The phylogenetic pattern of COG1560 is --------E-rHuj----inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 18-148 are 91% similar to a (ACYLTRANSFERASE BIOSYNTHESIS LIPID COMPLETE PROTEOME) protein domain (PD191353) which is seen in Q9L7U9_HAEDU.

Residues 97-148 are 75% similar to a (ACYLTRANSFERASE BIOSYNTHESIS IVA MSBB) protein domain (PD411684) which is seen in MSBB_HAEIN.

Residues 149-315 are identical to a (ACYLTRANSFERASE COMPLETE PROTEOME BIOSYNTHESIS LIPID) protein domain (PD011612) which is seen in Q9L7U9_HAEDU.



Paralogs:  Local Blast Search
HD0404 is paralogously related to HD1106 (6e-34).


Pfam Summary:  Pfam Search
Residues 11 to 307 (E-value = 3.6e-120) place HD0404 in the Lip_A_acyltrans family which is described as Bacterial lipid A biosynthesis acyltransferase (PF03279)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MEQITEKTGYTHKFLWVFLHPRYWVVWLGVLGLLILAYVPYRLRDKLATI
VGRVVSNYLKKKGKKQYYRADINLCYCFPEWSADKRAQVIEQMFINVAQT
MLGIGEIAVRSVAHLQKRSEFIGLNYLKQAKAKGKNIILLVPHTWSIDAS
GIILHTYGMPMVSMYNPHRNALVDWLWNATRERFGGKMHTRQNGIKPFLN
DIRKGNMGYFLPDEDFGEELSVYADFFATEKATLPGLNKMARVANAEVIP
MFPIYNAEKGVYQMEILPAIEFSGSSAQSAREMNKVIEYFVHKNPAQYVW
ILRLLKTQRNGQDIYKRS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACAGATTACAGAAAAAACGGGTTATACCCATAAATTTTTATGGGT
GTTTTTGCACCCTAGGTATTGGGTGGTGTGGTTAGGTGTGTTGGGATTAC
TCATTTTAGCCTATGTGCCTTATCGTTTACGCGATAAATTGGCAACTATT
GTGGGCAGAGTGGTAAGCAACTATCTGAAAAAAAAGGGTAAAAAGCAATA
TTACCGCGCAGATATTAACTTATGTTATTGTTTCCCAGAATGGTCAGCGG
ATAAGCGTGCGCAAGTGATCGAACAGATGTTTATTAATGTCGCTCAAACG
ATGTTAGGAATTGGTGAAATTGCTGTGCGTTCGGTCGCACATTTGCAAAA
ACGCAGTGAATTTATCGGTTTAAATTATTTGAAACAGGCTAAAGCTAAAG
GTAAAAATATTATTTTATTAGTACCGCATACGTGGTCAATTGATGCTTCA
GGTATTATTTTGCATACGTATGGAATGCCAATGGTGTCAATGTATAATCC
ACATCGCAACGCGCTTGTTGATTGGTTATGGAATGCGACACGTGAACGTT
TTGGCGGCAAAATGCATACTCGTCAAAATGGTATCAAACCTTTTTTAAAT
GATATTCGCAAAGGCAATATGGGATATTTTTTGCCAGATGAAGATTTTGG
TGAAGAATTAAGTGTCTATGCAGATTTTTTTGCAACTGAGAAAGCGACTT
TACCGGGCTTAAATAAAATGGCACGTGTGGCAAATGCAGAGGTTATCCCT
ATGTTTCCTATTTATAATGCTGAGAAAGGTGTTTATCAAATGGAAATTTT
ACCGGCGATTGAGTTTTCGGGATCTTCTGCGCAATCGGCGAGGGAAATGA
ACAAAGTGATTGAGTATTTTGTGCATAAAAATCCCGCACAATACGTTTGG
ATTTTACGGTTACTGAAAACACAACGAAACGGACAAGATATTTATAAACG
CTCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy