Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR284 IGR285 IGR286 IGR283 IGR287 HD0394 hcaT, - HD0391 nrdD, - HD0393 tdhA, - HD0388 rnfA, - HD0396 rdgC, - HD0392 trmU,asuE,mnmA, - HD0389 rnfC, - HD0398 HD0394 hcaT, - HD0391 nrdD, - HD0393 tdhA, - HD0388 rnfA, - HD0396 rdgC, - HD0392 trmU,asuE,mnmA, - HD0389 rnfC, - HD0398 Type: tandem, Name:  - 9 HD0394 hcaT, - HD0391 nrdD, - HD0393 tdhA, - HD0388 rnfA, - HD0396 rdgC, - HD0392 trmU,asuE,mnmA, - HD0389 rnfC, - HD0398 rnfB, - HD0397 rnfB, - HD0397
* Calculated from Protein Sequence

Gene ID: HD0393

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nrdD  

Definition:
ribonucleoside-triphosphate reductase

Gene Start:
313691

Gene Stop:
311910

Gene Length:
1782

Molecular Weight*:
67853

pI*:
6.60

Net Charge*:
-3.73

EC:
 

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Salvage of nucleosides and nucleotides  
Replication; DNA replication, restriction, modification, recombination, and repair  

Pathway: pathway table

Secondary Evidence:
MacDonald D, Lu P.
Related Articles, Links

Determination of DNA structure in solution: enzymatic deuteration of the ribose 2' carbon.
J Am Chem Soc. 2002 Aug 21;124(33):9722-3. No abstract available.
PMID: 12175227 [PubMed - indexed for MEDLINE]

2:
Sintchak MD, Arjara G, Kellogg BA, Stubbe J, Drennan CL.
Related Articles, Links

The crystal structure of class II ribonucleotide reductase reveals how an allosterically regulated monomer mimics a dimer.
Nat Struct Biol. 2002 Apr;9(4):293-300.
PMID: 11875520

Comment:


Blast Summary:  PSI-Blast Search
Residues 11-581 are 29% similar to >15643151 conserved hypothetical protein [Thermotoga maritima].

Otherwise, matches weakly in gapped BLAST to conserved hypotheticals and to anaerobic ribonucleoside-triphosphate reductases. Residues 86-589 are 24% similar to anaerobic ribonucleoside-triphosphate reductase from Pyrococcus abyssi (14520240|).

COGS Summary:  COGS Search
BeTs to 4 clades of COG1328
COG name: Oxygen-sensitive ribonucleoside-triphosphate reductase NrdD
Functional Class: F
The phylogenetic pattern of COG1328 is -Mtk--v-e--h---------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 324-443 are 32% similar to a (PROTEOME COMPLETE ANAEROBIC REDUCTASE) protein domain (PD009884) which is seen in Q9WYL6_THEMA.

Residues 87-190 are 33% similar to a (PROTEOME COMPLETE) protein domain (PD011513) which is seen in Q9WYL6_THEMA.



Paralogs:  Local Blast Search
HD0393 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MIRLQPNQLKDKLNFIEQYLNAKNAADGSKMDANANITQKNIATMENEMM
KDFFVQINRAKVSNKIAELFDAELASEYLRQIEHHEIYVHDETSLKPYCV
SVTMYPFLRYGLTKFGGESKAPKHLASFCGSFVNFVFAVSSQFAGAVATV
EFLTYFDYFARKDFGDDYLETHKQEICNHLQQVVYSINQPAAARGYQSVF
WNISLYDKYYFEAMFSQFVFPDFERPNWQTTAKLQLFFMKWFNQERTKAI
LTFPVITAAMLTEHGQCKDNQFADQMAEELSQGNSFFIYQSDNPDSLASC
CRLRNEIADHTFSYSLGAGGVATGSINVITINMNRLVQDKRDLAKEVEKI
HKYQYAYRKLMEDYLAAGMLPAYDAGFITLDKQFLTIGINGMAEAAESQG
LTVGYNQEYIDFVQSRLNVIFVANQTASQQYGVKFNTEFVPAENLGVKNA
KWDKQDGYFVPRDCYNSYFYLVEDQQINALDKFLLHGKQLIEWLDGGSAL
HLNLDESLSKVGYRSLLDIAAKTGCNYFCVNVKITICNECHYIDKRTLHH
CGKCGSANIDYGTRVIGYLKRVSAFSSARQQEHSLRFYHRQAA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATTCGTTTACAACCAAATCAACTCAAAGACAAATTAAACTTTATTGA
GCAATATTTGAACGCAAAAAATGCCGCAGACGGTTCAAAAATGGATGCAA
ATGCGAACATTACACAAAAAAATATTGCTACGATGGAAAACGAAATGATG
AAAGATTTTTTCGTACAGATTAATCGTGCCAAAGTAAGCAATAAAATTGC
TGAATTATTTGATGCTGAATTAGCGAGTGAGTACTTACGTCAAATTGAAC
ATCACGAAATCTATGTCCACGATGAAACCAGTCTCAAGCCTTATTGTGTT
TCCGTTACTATGTATCCTTTTTTGCGATATGGCTTAACTAAATTTGGCGG
AGAATCAAAAGCACCGAAACATTTGGCTTCATTTTGTGGTTCATTTGTTA
ACTTTGTATTTGCCGTGAGTTCACAATTTGCTGGCGCAGTTGCTACTGTT
GAATTTCTCACTTACTTTGACTATTTTGCCCGTAAAGATTTTGGTGATGA
CTATCTTGAAACGCATAAGCAAGAAATCTGTAACCACCTACAACAAGTTG
TCTATAGTATTAACCAACCCGCCGCTGCGCGTGGTTATCAAAGCGTCTTT
TGGAATATTTCCTTATATGATAAATATTATTTTGAAGCTATGTTTAGCCA
GTTTGTTTTCCCTGATTTTGAACGACCAAACTGGCAAACAACCGCGAAAT
TACAACTTTTCTTTATGAAATGGTTTAACCAAGAACGGACTAAAGCCATT
TTGACTTTTCCTGTTATCACGGCAGCTATGCTCACAGAGCACGGCCAATG
CAAAGATAATCAATTTGCTGATCAAATGGCAGAAGAACTTTCGCAAGGTA
ATTCATTCTTTATCTACCAATCAGATAATCCTGACTCTTTAGCGTCTTGC
TGTCGTTTACGCAATGAAATCGCGGATCATACATTTTCCTATTCGCTTGG
TGCGGGCGGTGTTGCTACCGGTTCAATTAACGTAATTACCATCAATATGA
ACCGCTTGGTGCAAGATAAACGCGATCTGGCAAAAGAAGTGGAAAAAATT
CATAAATATCAATACGCTTACCGTAAATTAATGGAAGACTATTTAGCCGC
AGGTATGTTGCCGGCGTATGATGCGGGTTTTATTACGTTAGATAAACAAT
TCTTAACGATCGGCATAAATGGTATGGCGGAAGCGGCAGAATCCCAGGGC
TTAACCGTTGGTTATAATCAAGAATATATTGATTTTGTGCAAAGCCGTCT
AAACGTTATTTTTGTAGCAAATCAAACCGCTTCACAACAATATGGAGTAA
AATTTAACACTGAGTTTGTACCTGCTGAAAATCTAGGCGTGAAAAACGCT
AAATGGGATAAACAAGACGGCTATTTCGTTCCTCGTGATTGCTATAATTC
ATATTTCTACCTAGTCGAAGATCAACAAATTAATGCGCTCGATAAATTCT
TATTACATGGTAAGCAATTAATTGAGTGGTTAGATGGTGGCTCTGCACTT
CATCTCAATTTAGATGAATCACTTTCTAAAGTAGGCTATCGCTCACTATT
AGATATTGCAGCAAAAACTGGCTGTAATTACTTTTGTGTCAATGTCAAAA
TAACTATCTGTAATGAATGCCATTATATTGATAAACGAACACTGCATCAT
TGTGGAAAATGTGGTTCAGCAAATATTGACTACGGCACACGCGTCATTGG
CTATTTAAAACGGGTTTCTGCCTTTAGTTCTGCCCGCCAACAGGAACATA
GTTTACGCTTTTATCATCGTCAAGCGGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy