Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR281 IGR282 IGR284 IGR285 IGR286 IGR280 IGR283 HD0394 hcaT, - HD0391 nrdD, - HD0393 tdhA, - HD0388 HD0387 rdgC, - HD0392 apbE, - HD0386 trmU,asuE,mnmA, - HD0389 nqrF, - HD0384 HD0394 hcaT, - HD0391 nrdD, - HD0393 tdhA, - HD0388 HD0387 rdgC, - HD0392 apbE, - HD0386 trmU,asuE,mnmA, - HD0389 nqrF, - HD0384 HD0394 hcaT, - HD0391 nrdD, - HD0393 tdhA, - HD0388 HD0387 rdgC, - HD0392 apbE, - HD0386 trmU,asuE,mnmA, - HD0389 nqrF, - HD0384
* Calculated from Protein Sequence

Gene ID: HD0389

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
trmU  asuE  mnmA  

Definition:
tRNA (5-methylaminomethyl-2-thiouridylate) methyltransferase

Gene Start:
308366

Gene Stop:
309532

Gene Length:
1167

Molecular Weight*:
43132

pI*:
5.40

Net Charge*:
-8.38

EC:
2.1.1.61  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Secondary Evidence:
Hagervall TG, Pomerantz SC, McCloskey JA.
Reduced misreading of asparagine codons by Escherichia coli tRNALys with hypomodified derivatives of
5-methylaminomethyl-2-thiouridine in the wobble position.
J Mol Biol. 1998 Nov 20;284(1):33-42.
PMID: 9811540

Comment:


Blast Summary:  PSI-Blast Search
Residues 7 to 387 are 74% ( EScore : 1e-166 ) identical to pir||D64144 probable ATPase HI0174 between residues 37 and 418 in [Haemophilus influenzae Rd]
Residues 7 to 387 are 74% ( EScore : 1e-166 ) identical to sp|P44551|TRMU_HAEIN between residues 2 and 383
Residues 29 to 387 are 72% ( EScore : 1e-154 ) identical to sp|P25745|TRMU_ECOLI TRNA between residues 6 and 364 in [Escherichia coli]
Residues 29 to 387 are 72% ( EScore : 1e-154 ) identical to pir||B64858 probable ATPase ycfB >1787378|gb|AAC74217.1| between residues 21 and 379 in [Escherichia coli]
Residues 22 to 387 are 67% ( EScore : 1e-146 ) identical to gb|AAF94287.1| (AE004193) tRNA between residues 5 and 372 in [Vibrio cholerae]
Residues 25 to 384 are 51% ( EScore : 1e-104 ) identical to sp|O35020|TRMU_BACSU between residues 3 and 358
Residues 31 to 384 are 53% ( EScore : 1e-103 ) identical to gb|AAF41910.1| (AE002506) tRNA between residues 10 and 357 in [Neisseria meningitidis MC58]
Residues 31 to 385 are 52% ( EScore : 1e-103 ) identical to emb|CAB84972.1| (AL162757) tRNA between residues 26 and 374 in [Neisseria meningitidis]
Residues 30 to 383 are 50% ( EScore : 2e-94 ) identical to gb|AAF84249.1|AE003974_4 tRNA methyltransferase between residues 5 and 356 in [Xylella fastidiosa]
Residues 87 to 384 are 54% ( EScore : 1e-90 ) identical to pir||G69978 probable ATPase yrrA - Bacillus subtilis >2635195|emb|CAB14691.1| between residues 7 and 300 in [Bacillus subtilis]

COGS Summary:  COGS Search
BeTs to 12 clades of COG0482
COG name: Predicted ATPase of the PP-family
Functional Class: R
The phylogenetic pattern of COG0482 is ----yQvcebrhUJgpo-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000541 (Uncharacterized protein family UPF0021) with a combined E-value of 8.8e-07.
    IPB000541B    29-47
    IPB000541D    131-169


ProDom Summary:  Protein Domain Search
Residues 193-384 are 83% similar to a (TRNA METHYLTRANSFERASE) protein domain (PD005022) which is seen in TRMU_PASMU.

Residues 29-160 are 79% similar to a (TRNA METHYLTRANSFERASE) protein domain (PD000352) which is seen in TRMU_HAEIN.



Paralogs:  Local Blast Search
HD0389 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 29 to 383 (E-value = 4.8e-215) place HD0389 in the tRNA_Me_trans family which is described as tRNA methyl transferase (PF03054)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRKHMALNSITYQKCFHTSAQQYADNKNKKVIIGMSGGVDSSVSAFILQQ
QGYQVEGLFMKNWEEDDDTDYCTAAADLADAQNVADRLGIKLHKINFAAE
YWDNVFEHFLAEYQAGRTPNPDILCNKEIKFKAFLEYAAEDLGADYIATG
HYVRRSADNENAQLLRGLDANKDQSYFLYTLSNQQVAKSLFPVGEIEKPM
VRQIATDLGLVTAKKKDSTGICFIGERKFKEFLARFLPAQPGDISTVEGE
IVGRHDGLMYYTLGQRKGLGIGGVKGLSEDPFYVVEKDLVNNVLIVAQGH
DNSALLSTGLIANQLHWVDRKTIGDTLRCTVKTRYRQTDIACLVEPIDAE
NIRVIFDEPQIAVTPGQSAVFYQGEVCLGGGVIEAQLK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGAAAACATATGGCATTAAATTCTATTACTTATCAAAAATGCTTTCA
TACTTCTGCGCAACAATATGCGGACAATAAAAATAAGAAAGTGATTATTG
GCATGTCAGGTGGTGTAGATTCTTCGGTTTCTGCCTTTATCCTTCAGCAA
CAAGGTTACCAAGTTGAAGGTTTATTTATGAAGAATTGGGAAGAGGATGA
TGATACCGATTATTGTACCGCAGCGGCGGATCTAGCGGACGCACAAAATG
TAGCAGATCGCCTAGGCATTAAGTTGCATAAAATTAATTTTGCGGCGGAA
TATTGGGATAATGTTTTTGAACATTTTTTAGCAGAATACCAAGCAGGTCG
AACGCCAAACCCTGATATTTTATGTAATAAAGAGATCAAATTTAAGGCAT
TTTTAGAATATGCTGCGGAGGATTTGGGGGCAGATTATATTGCAACAGGG
CATTATGTTCGCCGTTCGGCAGATAATGAAAATGCACAATTATTGCGTGG
TTTAGATGCAAATAAAGATCAAAGTTATTTTTTGTATACGTTAAGCAATC
AGCAAGTGGCGAAAAGTTTATTTCCAGTAGGTGAGATTGAAAAACCGATG
GTTCGTCAGATTGCAACTGATTTAGGATTGGTCACCGCGAAGAAAAAAGA
TTCAACGGGGATTTGCTTTATCGGTGAGCGTAAATTTAAGGAATTTTTAG
CGCGTTTTTTGCCCGCTCAACCAGGCGATATTAGCACGGTGGAAGGAGAA
ATTGTAGGTCGGCACGATGGCTTGATGTATTACACCTTAGGTCAGCGCAA
AGGGTTAGGGATCGGCGGTGTAAAGGGCTTGAGTGAAGATCCTTTTTATG
TGGTTGAGAAAGATTTAGTGAACAATGTATTAATTGTTGCACAAGGGCAT
GATAATTCAGCGTTATTATCGACCGGTTTAATTGCTAATCAATTACATTG
GGTCGATCGTAAAACTATAGGTGACACACTACGTTGTACGGTCAAAACTC
GTTATCGTCAGACGGATATTGCTTGTCTAGTCGAACCCATCGATGCTGAA
AATATTCGTGTTATTTTTGATGAACCACAAATTGCGGTAACGCCAGGCCA
ATCAGCCGTATTCTATCAAGGTGAAGTATGTCTTGGTGGGGGGGTGATTG
AAGCGCAACTTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy