Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR278 IGR277 IGR276 IGR279 IGR281 IGR282 IGR280 IGR283 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 apbE, - HD0386 trmU,asuE,mnmA, - HD0389 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 apbE, - HD0386 trmU,asuE,mnmA, - HD0389 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 apbE, - HD0386 trmU,asuE,mnmA, - HD0389 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379
* Calculated from Protein Sequence

Gene ID: HD0384

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nqrF  

Definition:
Na(+)-translocating NADH-quinone reductase subunit F

Gene Start:
303214

Gene Stop:
304443

Gene Length:
1230

Molecular Weight*:
45568

pI*:
4.90

Net Charge*:
-15.37

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Barquera B, Hellwig P, Zhou W, Morgan JE, Hase CC, Gosink KK, Nilges M,
Bruesehoff PJ, Roth A, Lancaster CR, Gennis RB.
Purification and characterization of the recombinant Na(+)-translocating
NADH:quinone oxidoreductase from Vibrio cholerae.
Biochemistry. 2002 Mar 19;41(11):3781-9.
PMID: 11888296

Steuber J.
Na(+) translocation by bacterial NADH:quinone oxidoreductases: an
extension to the complex-I family of primary redox pumps.
Biochim Biophys Acta. 2001 May 1;1505(1):45-56. Review.
PMID: 11248188

Hayashi M, Nakayama Y, Unemoto T.
Recent progress in the Na(+)-translocating NADH-quinone reductase from the
marine Vibrio alginolyticus.
Biochim Biophys Acta. 2001 May 1;1505(1):37-44. Review.
PMID: 11248187

Comment:


Blast Summary:  PSI-Blast Search
Residues 27 to 409 are 84% ( EScore : 0.0 ) identical to pir||D64052 Na+-translocating NADH-ubiquinone oxidoreductase between residues 29 and 411 in [Haemophilus influenzae Rd]
Residues 27 to 409 are 78% ( EScore : 1e-177 ) identical to gb|AAF40992.1| (AE002412) Na between residues 25 and 405 in [Neisseria meningitidis MC58]
Residues 27 to 409 are 77% ( EScore : 1e-177 ) identical to emb|CAB84030.1| (AL162754) putative Na between residues 25 and 405 in [Neisseria meningitidis]
Residues 27 to 409 are 76% ( EScore : 1e-172 ) identical to pir||S65531 Na+-translocating NADH-ubiquinone oxidoreductase between residues 25 and 407 in [Vibrio alginolyticus]
Residues 3 to 409 are 72% ( EScore : 1e-171 ) identical to gb|AAD29967.1|AF117331_6 NADH:ubiquinone oxidoreductase, Na translocating, beta subunit between residues 2 and 408 in [Vibrio cholerae]
Residues 27 to 409 are 74% ( EScore : 1e-169 ) identical to gb|AAF15416.1|AF165980_6 NqrF between residues 25 and 407 in [Vibrio harveyi]
Residues 81 to 376 are 81% ( EScore : 1e-144 ) identical to dbj|BAA83761.1| (AB024724) Na-translocating NADH-quinone reductase between residues 8 and 303 in [Photobacterium phosphoreum]
Residues 81 to 376 are 81% ( EScore : 1e-143 ) identical to dbj|BAA83762.1| (AB024725) Na-translocating NADH-quinone reductase between residues 8 and 303 in [Vibrio parahaemolyticus]
Residues 81 to 376 are 77% ( EScore : 1e-136 ) identical to dbj|BAA83764.1| (AB024727) Na-translocating NADH-quinone reductase between residues 8 and 303 in [Shewanella hanedai]
Residues 81 to 376 are 77% ( EScore : 1e-135 ) identical to dbj|BAA83757.1| (AB024720) Na-translocating NADH-quinone reductase between residues 8 and 303 in [Pseudoalteromonas haloplanktis]

COGS Summary:  COGS Search
BeTs to 10 clades of COG0543
COG name: 2-Octaprenylphenol hydroxylase and related flavodoxin oxidoreductases
Functional Class: H,C
The phylogenetic pattern of COG0543 is amtKYQV-EbRh-----lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** PR00410 (Phenol hydroxylase reductase family signature) with a combined E-value of 4.5e-11.
    PR00410B    211-218
    PR00410C    263-272
    PR00410D    278-297
    PR00410F    375-383
***** IPB001433 (Oxidoreductase FAD and NAD(P)-binding domain) with a combined E-value of 6.8e-06.
    IPB001433A    279-288
    IPB001433B    375-386


ProDom Summary:  Protein Domain Search
Residues 289-408 are 93% similar to a (OXIDOREDUCTASE IRON-SULFUR FLAVOPROTEIN TRANSPORT HEME) protein domain (PD011281) which is seen in Q56584_VIBAL.

Residues 127-210 are 94% similar to a (OXIDOREDUCTASE COMPLETE UBIQUINONE) protein domain (PD037063) which is seen in Q9CLA6_PASMU.

Residues 37-126 are 48% similar to a (IRON-SULFUR FERREDOXIN ELECTRON TRANSPORT CHLOROPLAST) protein domain (PD000232) which is seen in Q9K0M8_NEIMB.

Residues 290-408 are 42% similar to a (UBIQUINONE OXIDOREDUCTASE PROTEOME) protein domain (PD404718) which is seen in Q9Z723_CHLPN.

Residues 211-291 are 83% similar to a (REDUCTASE OXIDOREDUCTASE FLAVOPROTEIN FAD IRON-SULFUR) protein domain (PD264643) which is seen in Q9K0M8_NEIMB.

Residues 37-126 are 61% similar to a (COMPLETE PROTEOME OXIDOREDUCTASE SUBUNIT) protein domain (PD257355) which is seen in O05012_HAEIN.



Paralogs:  Local Blast Search
HD0384 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 40 to 118 (E-value = 3.7e-11) place HD0384 in the Fer2 family which is described as 2Fe-2S iron-sulfur cluster binding domain (PF00111)
Residues 135 to 269 (E-value = 8.3e-06) place HD0384 in the FAD_binding_6 family which is described as Oxidoreductase FAD-binding domain (PF00970)
Residues 274 to 391 (E-value = 1.7e-22) place HD0384 in the NAD_binding_1 family which is described as Oxidoreductase NAD-binding domain (PF00175)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VDNNFIFGIIAFTALVLVLAVIILFAKSKLVDSGDITISINDDPEKGITL
PAGGKLLGALASKGIFVSSACGGGGSCGQCKVQVNSGGGEILPTELSHIS
KKEAKEGWRLACQVNVKSSMDVELPEEIFGVKKWECTVISNDNKATFIKE
LKLQIPEGEEVPFRAGGYIQIEAEPHTVNYKDFDIPKEYHEDWDKFNLWR
YVSKVDEHIIRAYSMASYPEEKGIIMLNVRIATPPPRQPDAPPGQMSSYI
WSLKAGDKVTISGPFGEFFAKETDNEMVFIGGGAGMAPMRSHIFDQLKRL
KSKRKMSFWYGARSKREMFYVEDFDQLQAENDNFKWHVALSDPLPEDNWD
GYTGFIHNVLYENYLKNHEAPEDCEYYMCGPPVMNAAVIGMLKSLGVEDE
NILLDDFGG$

Gene Nucleotide Sequence:  Sequence Viewer
GTGGATAATAATTTTATTTTCGGTATTATCGCATTTACTGCTCTTGTGTT
AGTGCTTGCAGTGATTATTTTATTTGCTAAATCAAAATTAGTAGATTCGG
GCGATATTACTATCTCAATTAATGATGACCCTGAAAAAGGCATTACCCTA
CCAGCCGGTGGTAAATTATTGGGCGCGTTAGCTAGCAAAGGCATTTTCGT
TTCATCTGCTTGTGGCGGTGGCGGTTCATGTGGTCAATGTAAAGTACAAG
TTAACTCCGGCGGTGGTGAAATTTTACCAACTGAGCTATCACATATTTCT
AAGAAAGAAGCAAAAGAAGGGTGGCGTTTAGCTTGTCAGGTTAATGTTAA
ATCCTCAATGGATGTTGAATTGCCTGAAGAAATCTTTGGTGTTAAAAAGT
GGGAATGTACTGTTATTTCTAATGATAACAAAGCAACTTTCATCAAAGAG
CTTAAATTACAAATTCCTGAAGGGGAAGAAGTACCATTCCGAGCAGGTGG
CTATATTCAGATTGAGGCTGAACCGCATACGGTTAATTATAAAGACTTCG
ATATTCCAAAAGAATATCACGAAGATTGGGATAAATTTAACTTATGGCGC
TATGTTTCAAAAGTCGATGAGCATATTATTCGTGCTTACTCAATGGCATC
CTATCCAGAAGAAAAAGGCATTATTATGCTGAATGTACGGATTGCAACTC
CGCCACCACGCCAACCAGATGCACCTCCAGGTCAAATGTCTTCATATATT
TGGTCATTAAAAGCGGGTGATAAAGTAACTATTTCAGGCCCATTTGGTGA
GTTCTTTGCTAAAGAAACCGACAATGAAATGGTATTTATTGGTGGCGGTG
CAGGTATGGCACCAATGCGATCGCATATTTTTGACCAGTTAAAACGTTTA
AAATCTAAACGTAAAATGTCATTCTGGTATGGCGCACGTTCTAAACGTGA
AATGTTCTATGTAGAGGATTTTGATCAACTACAAGCTGAAAATGACAATT
TCAAATGGCATGTAGCACTTTCAGATCCACTCCCTGAGGATAATTGGGAT
GGTTACACGGGCTTTATTCATAATGTGCTTTATGAGAACTACTTGAAAAA
TCACGAAGCACCGGAAGATTGTGAATACTATATGTGTGGTCCACCAGTGA
TGAATGCCGCAGTGATAGGTATGCTGAAGAGTTTAGGTGTTGAAGACGAA
AATATCTTATTAGATGATTTCGGTGGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy