Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR278 IGR277 IGR276 IGR279 IGR281 IGR282 IGR280 IGR275 orfG, - HD0378 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 apbE, - HD0386 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 orfG, - HD0378 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 apbE, - HD0386 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 orfG, - HD0378 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 apbE, - HD0386 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379
* Calculated from Protein Sequence

Gene ID: HD0383

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nqrE  

Definition:
Na(+)-translocating NADH-quinone reductase subunit E

Gene Start:
302607

Gene Stop:
303203

Gene Length:
597

Molecular Weight*:
21189

pI*:
5.10

Net Charge*:
-2.63

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Residues 1 to 198 are 76% ( EScore : 4e-84 ) identical to sp|P71342|NQRE_HAEIN NA between residues 1 and 198 in [Haemophilus influenzae Rd]
Residues 1 to 198 are 77% ( EScore : 7e-84 ) identical to gb|AAF15415.1|AF165980_5 NqrE between residues 1 and 198 in [Vibrio harveyi]
Residues 1 to 198 are 76% ( EScore : 1e-83 ) identical to sp|Q56589|NQRE_VIBAL NA between residues 1 and 198 in [Vibrio alginolyticus]
Residues 1 to 198 are 77% ( EScore : 4e-83 ) identical to gb|AAD29966.1|AF117331_5 NADH:ubiquinone oxidoreductase, Na translocating, hydrophobic membrane protein NqrE between residues 1 and 198 in [Vibrio cholerae]
Residues 1 to 198 are 77% ( EScore : 4e-81 ) identical to gb|AAF40993.1| (AE002412) Na between residues 1 and 197 in [Neisseria meningitidis MC58]
Residues 1 to 198 are 77% ( EScore : 7e-81 ) identical to emb|CAB84031.1| (AL162754) putative Na between residues 1 and 197 in [Neisseria meningitidis]
Residues 2 to 198 are 64% ( EScore : 2e-72 ) identical to emb|CAA21366.1| (AL031866) between residues 3 and 199
Residues 3 to 198 are 50% ( EScore : 1e-47 ) identical to pir||F71535 probable NADH between residues 10 and 211 in [Chlamydia trachomatis]
Residues 3 to 198 are 47% ( EScore : 1e-45 ) identical to gb|AAF39392.1| (AE002323) NADH:ubiquinone oxidoreductase, subunit E, putative between residues 10 and 211 in [Chlamydia muridarum]
Residues 3 to 198 are 45% ( EScore : 9e-43 ) identical to pir||H72078 nadh between residues 10 and 211 in [Chlamydophila pneumoniae]

COGS Summary:  COGS Search
BeTs to 3 clades of COG2209
COG name: Na+-translocating NADH-quinone oxidoreductase, subunit 5 (NqrE)
Functional Class: C
The phylogenetic pattern of COG2209 is ------v-e--H------in-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB003667 (RnfA-Nqr electron transport subunit) with a combined E-value of 4.9e-88.
    IPB003667A    12-44
    IPB003667B    78-130
    IPB003667C    139-169
    IPB003667D    179-187


ProDom Summary:  Protein Domain Search
Residues 7-196 are 84% similar to a (COMPLETE PROTEOME UBIQUINONE SUBUNIT) protein domain (PD006282) which is seen in Q9CLA7_PASMU.



Paralogs:  Local Blast Search
HD0383 is paralogously related to HD0396 (5e-39), HD0403 (1e-14) and HD0382 (7e-11).


Pfam Summary:  Pfam Search
Residues 1 to 198 (E-value = 1e-111) place HD0383 in the Rnf-Nqr family which is described as Rnf-Nqr subunit, membrane protein (PF02508)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MEHLLSIFVKSVFIENMALSFFLGMCTFLAVSKKVSTAFGLGIAVIVVLG
IAVPVNQLVYTHILKDGVLVDGVDLSFLNFITFIGVIAALVQILEMILDK
FFPALYSALGIFLPLITVNCAIFGGVSFMVQREYDLVESVVYGIGAGTGW
MLAIVALAGLTEKMKYSDVPAGLRGLGITFITVGLMALGFMSFSGIQL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAACATCTTTTAAGTATCTTCGTTAAGTCCGTATTTATTGAAAATAT
GGCGCTTTCTTTCTTCCTTGGCATGTGTACATTCCTTGCGGTGTCTAAGA
AAGTTTCGACCGCTTTTGGCTTAGGGATTGCGGTTATTGTAGTATTAGGC
ATAGCTGTACCTGTAAATCAACTTGTTTATACTCATATATTAAAAGACGG
TGTGTTAGTTGATGGCGTAGATTTAAGTTTCTTAAACTTCATTACTTTTA
TCGGGGTCATTGCCGCACTTGTTCAAATCCTTGAAATGATTTTAGACAAG
TTCTTCCCTGCGCTTTACAGTGCACTAGGGATTTTCTTACCGCTTATTAC
AGTAAACTGTGCGATTTTTGGTGGGGTATCATTTATGGTTCAACGTGAAT
ATGATCTAGTTGAATCAGTAGTTTATGGTATTGGTGCCGGTACGGGGTGG
ATGTTAGCAATTGTTGCCCTTGCAGGTTTAACCGAGAAAATGAAATATTC
AGATGTACCAGCAGGCTTACGTGGTTTAGGCATTACATTTATTACTGTTG
GCCTAATGGCATTAGGTTTTATGTCTTTCTCAGGCATTCAATTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy