Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR278 IGR277 IGR276 IGR279 IGR281 IGR282 IGR274 IGR280 IGR275 orfG, - HD0378 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 add, - HD0377 apbE, - HD0386 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 orfG, - HD0378 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 add, - HD0377 apbE, - HD0386 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 orfG, - HD0378 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 add, - HD0377 apbE, - HD0386 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379
* Calculated from Protein Sequence

Gene ID: HD0382

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nqrD  

Definition:
Na(+)-translocating NADH-quinone reductase subunit D

Gene Start:
301982

Gene Stop:
302605

Gene Length:
624

Molecular Weight*:
22479

pI*:
9.30

Net Charge*:
2.89

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Barquera B, Hellwig P, Zhou W, Morgan JE, Hase CC, Gosink KK, Nilges M, Bruesehoff PJ, Roth A, Lancaster CR, Gennis RB.
Purification and characterization of the recombinant Na(+)-translocating NADH:quinone oxidoreductase from Vibrio cholerae.
Biochemistry. 2002 Mar 19;41(11):3781-9.
PMID: 11888296

Barquera B, Hase CC, Gennis RB.
Expression and mutagenesis of the NqrC subunit of the NQR respiratory Na(+) pump from Vibrio cholerae with covalently attached FMN.
FEBS Lett. 2001 Mar 9;492(1-2):45-9.
PMID: 11248234

Comment:
From GenBank (gi:15214142): The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinal by two successive reactions, coupled with the transport of NA(+) ions from the cytoplasm to the periplasm. The first step is catalyzed by NQRF, which accepts electrons from NADH and reduces ubiquinone-1 to ubisemiquinone by a one electron transfer pathway. The NQR
complex located in the inner membrane (potential) and is composed of six subunits NqrA, NqrB, NqrC, NqrD, NqrE, and NqrF.

From GenBank (gi:6093529): NqrA to NqrE are probably involved in the second
step, the conversion of ubisemiquinone to ubiquinol.

Blast Summary:  PSI-Blast Search
Residues 7 to 207 are 84% ( EScore : 3e-94 ) identical to sp|P43958|Y168_HAEIN HYPOTHETICAL PROTEIN HI0168 >1573125|gb|AAC21839.1| between residues 8 and 208 in [Haemophilus influenzae Rd]
Residues 6 to 207 are 79% ( EScore : 2e-89 ) identical to gb|AAF40994.1| (AE002412) Na between residues 7 and 208 in [Neisseria meningitidis MC58]
Residues 6 to 207 are 79% ( EScore : 2e-89 ) identical to emb|CAB84032.1| (AL162754) putative Na between residues 7 and 208 in [Neisseria meningitidis]
Residues 6 to 206 are 76% ( EScore : 1e-86 ) identical to gb|AAD29965.1|AF117331_4 NADH:ubiquinone oxidoreductase, Na translocating, hydrophobic membrane protein NqrD between residues 7 and 207 in [Vibrio cholerae]
Residues 5 to 206 are 73% ( EScore : 2e-84 ) identical to pir||S65529 NADH dehydrogenase between residues 6 and 207 in [Vibrio alginolyticus]
Residues 5 to 206 are 73% ( EScore : 3e-84 ) identical to gb|AAF15414.1|AF165980_4 NqrD between residues 6 and 207 in [Vibrio harveyi]
Residues 85 to 207 are 85% ( EScore : 1e-57 ) identical to pir||D64003 between residues 1 and 123
Residues 2 to 197 are 48% ( EScore : 1e-50 ) identical to pir||G72078 nadh between residues 3 and 203 in [Chlamydophila pneumoniae]
Residues 17 to 207 are 48% ( EScore : 5e-48 ) identical to gb|AAF39391.1| (AE002323) NADH:ubiquinone oxidoreductase, subunit D, putative between residues 18 and 213 in [Chlamydia muridarum]
Residues 17 to 197 are 52% ( EScore : 3e-47 ) identical to pir||E71535 probable NADH between residues 18 and 203 in [Chlamydia trachomatis]

COGS Summary:  COGS Search
BeTs to 3 clades of COG1347
COG name: Na+-translocating NADH-quinone reductase, subunit 5
Functional Class: C
The phylogenetic pattern of COG1347 is ------v-e--H------in-
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB003667 (RnfA-Nqr electron transport subunit) with a combined E-value of 1.3e-75.
    IPB003667A    14-46
    IPB003667B    69-121
    IPB003667C    129-159
    IPB003667D    191-199


ProDom Summary:  Protein Domain Search
Residues 9-152 are 84% similar to a (COMPLETE PROTEOME UBIQUINONE SUBUNIT) protein domain (PD006282) which is seen in Y168_HAEIN.

Residues 153-207 are 83% similar to a (COMPLETE PROTEOME NA-TRANSLOCATING) protein domain (PD036369) which is seen in Y168_HAEIN.



Paralogs:  Local Blast Search
HD0382 is paralogously related to HD0403 (2e-29), HD0396 (9e-14) and HD0383 (8e-11).


Pfam Summary:  Pfam Search
Residues 3 to 195 (E-value = 7.5e-97) place HD0382 in the Rnf-Nqr family which is described as Rnf-Nqr subunit, membrane protein (PF02508)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MANNNLKKLLLSPISDNNPIALQILGICSALAVTTQLQTAFVMAIAVSLV
TAFSSMFISMIRNYIPNSIRIIVQMAIIASLVILVDQILRAYVYDLSKQL
SVFVGLIITNCIVMGRAEAFAMKSAPLESFVDGIGNGLGYGAMLVIVAFL
RELIGSGKIFGVTVLQTIQDGGWYQANGLFLLAPSAFFIIGFVIWAIRTW
KPEQVEK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAATAACAATCTTAAAAAGTTATTGTTATCTCCAATCTCAGATAA
CAATCCAATTGCATTACAGATCTTAGGTATTTGTTCTGCGCTTGCTGTAA
CTACACAGTTACAAACAGCATTCGTAATGGCCATTGCGGTGAGTTTAGTA
ACCGCATTCTCTAGTATGTTTATTTCAATGATCCGTAACTATATTCCAAA
TAGTATTCGTATTATTGTACAAATGGCAATTATTGCTTCTTTGGTTATTC
TTGTAGACCAAATATTGCGTGCCTATGTTTATGACTTATCGAAACAGCTT
TCTGTTTTTGTTGGTCTTATTATTACTAACTGTATCGTTATGGGACGTGC
AGAAGCATTTGCAATGAAATCAGCTCCGCTTGAAAGTTTTGTAGATGGTA
TTGGTAATGGCTTAGGTTATGGTGCGATGTTAGTTATTGTCGCTTTTTTA
CGCGAATTAATTGGTTCAGGTAAAATCTTTGGTGTTACTGTTTTACAAAC
TATCCAAGATGGTGGTTGGTATCAAGCGAATGGTTTATTCTTATTAGCAC
CAAGTGCGTTCTTTATCATCGGTTTTGTGATTTGGGCGATCAGAACTTGG
AAACCAGAGCAAGTGGAGAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy