Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR278 IGR277 IGR276 IGR279 IGR281 IGR282 IGR274 IGR280 IGR275 orfG, - HD0378 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 add, - HD0377 apbE, - HD0386 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 orfG, - HD0378 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 add, - HD0377 apbE, - HD0386 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 orfG, - HD0378 tdhA, - HD0388 HD0387 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 add, - HD0377 apbE, - HD0386 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379
* Calculated from Protein Sequence

Gene ID: HD0381

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nqrC  

Definition:
Na(+)-translocating NADH-quinone reductase subunit C

Gene Start:
301209

Gene Stop:
301982

Gene Length:
774

Molecular Weight*:
27668

pI*:
5.90

Net Charge*:
-1.57

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Comment:


Blast Summary:  PSI-Blast Search
Residues 18 to 271 are 58% ( EScore : 2e-80 ) identical to emb|CAB84033.1| (AL162754) putative Na between residues 4 and 257 in [Neisseria meningitidis]
Residues 18 to 271 are 58% ( EScore : 3e-79 ) identical to gb|AAF40995.1| (AE002412) Na between residues 4 and 257 in [Neisseria meningitidis MC58]
Residues 16 to 272 are 55% ( EScore : 7e-76 ) identical to sp|P43957|Y167_HAEIN HYPOTHETICAL PROTEIN HI0167 >1074289|pir||B64003 hypothetical protein HI0167 between residues 1 and 244 in [Haemophilus influenzae Rd]
Residues 46 to 266 are 52% ( EScore : 6e-62 ) identical to pir||S65528 Na+-translocating NADH-ubiquinone oxidoreductase between residues 30 and 251 in [Vibrio alginolyticus]
Residues 46 to 266 are 52% ( EScore : 2e-61 ) identical to gb|AAF15413.1|AF165980_3 NqrC between residues 30 and 256 in [Vibrio harveyi]
Residues 46 to 266 are 54% ( EScore : 3e-61 ) identical to gb|AAD29964.1|AF117331_3 NADH:ubiquinone oxidoreductase, Na translocating, gamma subunit between residues 30 and 252 in [Vibrio cholerae]
Residues 46 to 266 are 51% ( EScore : 3e-60 ) identical to pir||S51017 Na+-translocating NADH-ubiquinone oxidoreductase between residues 30 and 251 in [Vibrio alginolyticus]
Residues 151 to 251 are 43% ( EScore : 6e-20 ) identical to pir||D71535 probable NADH between residues 176 and 292 in [Chlamydia trachomatis]
Residues 151 to 261 are 40% ( EScore : 4e-19 ) identical to gb|AAF39390.1| (AE002323) NADH:ubiquinone oxidoreductase, gamma subunit, putative between residues 177 and 298 in [Chlamydia muridarum]
Residues 141 to 249 are 36% ( EScore : 1e-16 ) identical to pir||F72078 nadh between residues 171 and 295 in [Chlamydophila pneumoniae]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 31-252 are 63% similar to a (UBIQUINONE COMPLETE PROTEOME) protein domain (PD038728) which is seen in Q9CLA9_PASMU.



Paralogs:  Local Blast Search
HD0381 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 138 to 241 (E-value = 2.5e-41) place HD0381 in the FMN_bind family which is described as FMN-binding domain (PF04205)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAKFNKDSVSGTLTVVVLLSLICSLIVASAAVLLKPTQDIQKQLDKQKNI
LQAAGLMHENTNVQETYAKFIEPKIVDLATGDYVEDVANFDAKAFAKDPA
TSVAIKPEDDKANIRMRAKYAEVYLVKDEMGQTTQVVLPMYGNGLWSMMY
GFVAVQPDANTVNGITYYEQGETAGLGGEIANPNWQKSFVGKKLFNANNE
VALTIGKGASADKEHGVDGLSGATLTSKGVDNSFKYWFGTNGFGPYLAKF
KATAGAN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTAAATTTAATAAAGATAGCGTAAGCGGTACTTTAACGGTTGTTGT
GTTATTAAGTTTAATTTGTTCTCTGATTGTAGCAAGTGCTGCCGTGTTGT
TAAAACCAACACAAGATATTCAGAAACAACTTGATAAACAAAAAAATATC
TTACAAGCGGCAGGTTTAATGCATGAAAATACCAATGTGCAAGAAACCTA
TGCTAAGTTCATTGAGCCAAAAATTGTTGATTTGGCAACAGGTGATTATG
TTGAAGATGTAGCAAATTTTGATGCAAAAGCATTTGCAAAAGATCCCGCA
ACAAGCGTAGCAATTAAACCAGAAGACGACAAAGCAAATATTAGAATGCG
TGCTAAATATGCGGAAGTATATTTAGTTAAAGATGAAATGGGCCAAACAA
CGCAAGTAGTGTTACCTATGTATGGTAATGGTTTATGGTCTATGATGTAT
GGTTTTGTGGCGGTACAACCTGATGCGAATACGGTGAATGGTATTACTTA
TTATGAACAAGGTGAAACAGCCGGTTTAGGTGGGGAAATTGCTAATCCTA
ATTGGCAAAAAAGCTTTGTTGGTAAGAAATTATTTAATGCCAATAATGAA
GTTGCTTTAACGATTGGGAAAGGCGCTTCAGCAGATAAAGAGCATGGTGT
TGATGGTTTATCCGGTGCAACTTTAACGTCTAAAGGTGTCGATAATTCAT
TTAAATATTGGTTCGGTACAAATGGCTTCGGTCCATATTTAGCTAAATTT
AAAGCAACTGCAGGGGCGAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy