Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR278 IGR277 IGR276 IGR279 IGR271 IGR272 IGR274 IGR273 IGR275 orfG, - HD0378 HD0376 HD0374 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 HD0375 add, - HD0377 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 orfG, - HD0378 HD0376 HD0374 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 HD0375 add, - HD0377 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 orfG, - HD0378 HD0376 nqrE, - HD0383 nqrD, - HD0382 nqrC, - HD0381 HD0375 add, - HD0377 nqrF, - HD0384 nqrB, - HD0380 nqrA, - HD0379 HD0374
* Calculated from Protein Sequence

Gene ID: HD0379

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nqrA  

Definition:
Na+ translocating NADH-quinone reductase subunit A

Gene Start:
298588

Gene Stop:
299970

Gene Length:
1383

Molecular Weight*:
49840

pI*:
7.20

Net Charge*:
0.76

EC:
1.6.5.3  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Menaquinone and ubiquinone  

Pathway: pathway table
Oxidative phosphorylation
Ubiquinone biosynthesis

Secondary Evidence:
Barquera B, Hellwig P, Zhou W, Morgan JE, Hase CC, Gosink KK, Nilges M, Bruesehoff PJ, Roth A, Lancaster CR, Gennis RB.
Purification and characterization of the recombinant Na(+)-translocating NADH:quinone oxidoreductase from Vibrio cholerae.
Biochemistry. 2002 Mar 19;41(11):3781-9.
PMID: 11888296

Comment:
From GenBank (gi:15214142): The NQR complex catalyzes the reduction of ubiquinone-1 to ubiquinal by two successive reactions, coupled with the transport of NA(+) ions from the cytoplasm to the periplasm. The first step is catalyzed by NQRF, which accepts electrons from NADH and reduces ubiquinone-1 to ubisemiquinone by a one electron transfer pathway. The NQR complex located in the inner membrane (potential) and is composed of six subunits NqrA, NqrB, NqrC, NqrD, NqrE, and NqrF.

From GenBank (gi:6093529): NqrA to NqrE are probably involved in the second step, the conversion of ubisemiquinone to ubiquinol.

Blast Summary:  PSI-Blast Search
Residues 18 to 460 are 83% ( EScore : 0.0 ) identical to gb|AAC43631.1| (U24492) 48 kDa outer membrane protein between residues 1 and 449 in [Actinobacillus pleuropneumoniae]
Residues 18 to 460 are 71% ( EScore : 0.0 ) identical to sp|P43955|Y164_HAEIN HYPOTHETICAL PROTEIN HI0164 >1573122|gb|AAC21836.1| between residues 1 and 447 in [Haemophilus influenzae Rd]
Residues 18 to 460 are 66% ( EScore : 1e-166 ) identical to emb|CAB84035.1| (AL162754) putative Na between residues 1 and 447 in [Neisseria meningitidis]
Residues 18 to 460 are 66% ( EScore : 1e-165 ) identical to gb|AAF40997.1| (AE002412) Na between residues 1 and 447 in [Neisseria meningitidis MC58]
Residues 18 to 460 are 62% ( EScore : 1e-155 ) identical to pir||S51015 Na+-translocating NADH-ubiquinone oxidoreductase between residues 1 and 446 in [Vibrio alginolyticus]
Residues 18 to 460 are 60% ( EScore : 1e-152 ) identical to gb|AAD29962.1|AF117331_1 NqrA between residues 1 and 446 in [Vibrio cholerae]
Residues 18 to 460 are 60% ( EScore : 1e-152 ) identical to gb|AAF95439.1| (AE004300) NADH:ubiquinone oxidoreductase, Na translocating, alpha subunit between residues 17 and 462 in [Vibrio cholerae]
Residues 18 to 460 are 61% ( EScore : 1e-152 ) identical to gb|AAF15411.1|AF165980_1 NqrA between residues 1 and 446 in [Vibrio harveyi]
Residues 18 to 368 are 71% ( EScore : 1e-145 ) identical to pir||I64002 between residues 1 and 355
Residues 18 to 459 are 30% ( EScore : 3e-55 ) identical to gb|AAD33930.1|AF144076_1 50 kD antigen PG1 between residues 4 and 449 in [Porphyromonas gingivalis]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0379 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 460 (E-value = 1e-302) place HD0379 in the NQRA family which is described as Na(+)-translocating NADH-quinone reductase subunit A (NQRA) (PF05896)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LRFSQSYFLTQKSSANNMITIKKGLDLPIAASPAQVIHNGNTVNEVAMLG
EEYVGMRPSMKVREGDLVKKGQVLFEDKKNAGVVFTAPASGTVVAINRGE
KRVLQSVVIKVEGDEQITFTRYEAAQLASLSAEQVRANLIDAGLWIAFRT
RPFSKVPAVDATPASIFVNAMDTNPLSADPAVIINEYKNDFEYGLTVLIR
LGVKVNLVKAAGVNIPTVDGITVHEFAGKHPAGLVGTHIHFIDPVNLTKT
VWHLNYQDVIAFGKLFTTGELFTDRVVALAGPQVKTPRLVRTRLGANLSQ
LTTGELNVGENRIISGSVLSGATASGPVDFLGRYALQVSVLLEGCEKELL
GWVMPGSDKYSITRTVLGHFRKKLFNFTTAVHGGERAMVPIGAYERVMPL
DIIPTLLLRDLAAGDTDSAQNLGCLELDEEDLALCTYVCPGKNNYGPMLR
TALDKIEKEG$

Gene Nucleotide Sequence:  Sequence Viewer
TTGCGATTTTCGCAATCTTATTTTTTAACCCAAAAAAGTAGTGCAAATAA
TATGATTACAATTAAAAAAGGCTTGGATTTACCTATTGCAGCTTCGCCAG
CACAAGTAATCCATAACGGCAATACCGTTAATGAAGTTGCGATGCTTGGT
GAGGAATATGTGGGTATGCGTCCTTCAATGAAAGTACGTGAAGGAGATTT
AGTGAAAAAAGGTCAAGTACTTTTTGAAGATAAAAAGAATGCTGGCGTAG
TTTTTACCGCACCTGCAAGTGGTACTGTGGTTGCGATTAACCGTGGTGAA
AAGCGTGTTCTTCAATCAGTCGTGATTAAAGTTGAGGGTGATGAACAAAT
TACCTTTACCCGCTATGAAGCAGCTCAGTTAGCTTCTTTGTCAGCAGAGC
AAGTGAGAGCTAATCTTATTGACGCTGGTTTATGGATAGCGTTCCGTACT
CGTCCATTCAGCAAAGTTCCTGCTGTAGATGCGACACCTGCCTCGATTTT
TGTGAATGCAATGGATACTAATCCATTAAGTGCAGATCCTGCCGTCATTA
TCAATGAATATAAAAATGATTTTGAATATGGTTTAACTGTATTAATTCGT
TTAGGTGTTAAGGTGAATTTAGTCAAAGCAGCGGGTGTAAATATTCCTAC
TGTAGATGGCATTACTGTACACGAATTTGCCGGCAAACATCCGGCTGGCT
TAGTGGGTACACATATTCATTTTATTGATCCTGTTAACTTAACTAAAACT
GTGTGGCATCTAAATTATCAAGATGTAATTGCTTTCGGTAAATTATTCAC
AACCGGTGAGTTATTTACTGATCGTGTAGTTGCTTTGGCAGGGCCACAAG
TGAAAACACCTCGTTTAGTGCGCACTCGTTTGGGTGCAAACCTTTCTCAA
TTAACGACCGGTGAATTAAACGTGGGCGAAAATCGTATTATTTCTGGTTC
AGTATTAAGTGGTGCTACTGCAAGTGGCCCTGTGGATTTTTTAGGTCGTT
ATGCATTACAAGTGTCAGTGTTATTAGAAGGGTGTGAAAAAGAGCTATTG
GGATGGGTTATGCCTGGCTCGGATAAATACTCGATTACGCGTACTGTATT
AGGACATTTTCGTAAAAAATTATTCAATTTTACGACGGCTGTCCACGGTG
GTGAACGGGCAATGGTGCCAATCGGTGCTTACGAACGTGTAATGCCGTTA
GATATTATTCCAACGTTATTATTACGTGATTTAGCTGCTGGCGACACAGA
TTCAGCCCAAAATTTAGGCTGTTTAGAACTAGATGAAGAAGATTTAGCAC
TGTGTACCTATGTTTGTCCGGGCAAAAATAACTACGGTCCTATGTTACGT
ACAGCGTTAGATAAGATCGAGAAGGAAGGGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy