Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR277 IGR276 IGR271 IGR272 IGR274 IGR270 IGR273 IGR269 IGR275 orfG, - HD0378 HD0376 HD0374 nqrC, - HD0381 HD0375 add, - HD0377 nqrB, - HD0380 nqrA, - HD0379 pyrG, - HD0373 orfG, - HD0378 HD0376 HD0374 nqrC, - HD0381 HD0375 add, - HD0377 nqrB, - HD0380 nqrA, - HD0379 pyrG, - HD0373 orfG, - HD0378 HD0376 HD0374 nqrC, - HD0381 HD0375 add, - HD0377 nqrB, - HD0380 nqrA, - HD0379 pyrG, - HD0373
* Calculated from Protein Sequence

Gene ID: HD0377

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
add  

Definition:
adenosine deaminase

Gene Start:
296429

Gene Stop:
297463

Gene Length:
1035

Molecular Weight*:
37821

pI*:
5.30

Net Charge*:
-7.68

EC:
3.5.4.4  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Chang,Z.Y., Nygaard,P., Chinault,A.C. and Kellems,R.E.
Deduced amino acid sequence of Escherichia coli adenosine deaminase reveals evolutionarily conserved amino acid residues: implications for catalytic function
Biochemistry 30 (8), 2273-2280 (1991)
Medline: 91152042

Petersen C, Moller LB, Valentin-Hansen P.
The cryptic adenine deaminase gene of Escherichia coli. Silencing by the nucleoid-associated DNA-binding protein, H-NS, and activation by insertion elements.
J Biol Chem. 2002 Aug 30;277(35):31373-80.
PMID: 12077137

Matsui H, Shimaoka M, Kawasaki H, Takenaka Y, Kurahashi O.
Adenine deaminase activity of the yicP gene product of Escherichia coli.
Biosci Biotechnol Biochem. 2001 May;65(5):1112-8.
PMID: 11440125

Comment:


Blast Summary:  PSI-Blast Search
Residues 60-336 are 45% similar to residues 1-282 of >21623744 putative adenosine deaminase [Lactobacillus helveticus].

Residues 13 to 336 are 34% ( EScore : 4e-48 ) identical to pir||T35340 probable adenosine deaminase - Streptomyces coelicolor >4835327|emb|CAB42949.1| between residues 19 and 350 in [Streptomyces coelicolor A3(2)]
Residues 12 to 334 are 36% ( EScore : 1e-46 ) identical to gb|AAF95890.1| (AE004340) adenosine deaminase between residues 10 and 328 in [Vibrio cholerae]
Residues 12 to 332 are 34% ( EScore : 4e-44 ) identical to sp|P22333|ADD_ECOLI ADENOSINE DEAMINASE between residues 10 and 326 in [Escherichia coli]
Residues 13 to 336 are 32% ( EScore : 5e-44 ) identical to pir||H70842 probable add protein - Mycobacterium tuberculosis between residues 18 and 352 in [Mycobacterium tuberculosis]
Residues 12 to 332 are 34% ( EScore : 7e-44 ) identical to pir||A37943 adenosine deaminase between residues 10 and 325 in [Escherichia coli]
Residues 37 to 344 are 31% ( EScore : 3e-39 ) identical to pir||S73031 adenosine deaminase between residues 13 and 331 in [Mycobacterium leprae]
Residues 11 to 340 are 29% ( EScore : 6e-37 ) identical to gb|AAB07142.1| (M34252) adenosine deaminase between residues 12 and 351 in [Mus musculus]
Residues 11 to 340 are 29% ( EScore : 8e-37 ) identical to pdb|1A4M|A between residues 9 and 348
Residues 11 to 340 are 29% ( EScore : 8e-37 ) identical to ref|NP_031424.1|| adenosine deaminase >113340|sp|P03958|ADA_MOUSE ADENOSINE DEAMINASE between residues 12 and 351 in [Mus musculus]
Residues 11 to 340 are 29% ( EScore : 2e-36 ) identical to pdb|1FKX| between residues 9 and 348

COGS Summary:  COGS Search
BeTs to 4 clades of COG1816
COG name: Adenosine deaminase
Functional Class: F
The phylogenetic pattern of COG1816 is ----y---e-r------l---
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 12-127 are 28% similar to a (ADENOSINE NUCLEOTIDE METABOLISM DEAMINASE) protein domain (PD397165) which is seen in ADD_ECOLI.

Residues 202-285 are 38% similar to a (ADENOSINE DEAMINASE PROTEOME COMPLETE) protein domain (PD414324) which is seen in ADA_YEAST.

Residues 13-268 are 35% similar to a (ADENOSINE DEAMINASE HYDROLASE PROTEOME) protein domain (PD008716) which is seen in Q9CCL9_MYCLE.



Paralogs:  Local Blast Search
HD0377 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 12 to 335 (E-value = 2.1e-66) place HD0377 in the A_deaminase family which is described as Adenosine/AMP deaminase (PF00962)

PDB Hit:
pdb|2ADA| Adenosine Deaminase (E.C.3.5.4.4) Complexed With 6-... 155 9e-039
pdb|1A4M|A Chain A, Ada Structure Complexed With Purine Ribosid... 155 9e-039
pdb|1FKX| Murine Adenosine Deaminase (D296a) 153 2e-038

Gene Protein Sequence:
MVLGLAQYGVIDLHLHLDGSLSPAWMIEWAKKQAVNLPASTAEALTAYVS
VPQDCSDLNEYLRCFDLPLSLLQTPEALSSAVTDLIQRLDQDGLVYAEIR
FAPQLHTQRSMSQEDAVKAALRGLQAGLASTSLFKANLILCCMRAADNRS
ANLETICLAKQYLTKYEAGVVAIDLAGAEGLFATQHFQQEFDFANQRGVP
FTIHAGEAAGPESVQQALDFGATRIGHGIRAIESETVMKQLIDKRTPLEM
CPCSNLQTKTVAQLADYPLRTFLMRGVVATLNTDNMTVSQTCIQQEYRLL
AEQYQLSISEAKQLLLNSIAAAFLSNEDKKALLAHIQQRYPQLI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTTTAGGCTTAGCACAATATGGTGTGATTGATTTACACTTACATTT
AGATGGTTCTTTATCACCTGCGTGGATGATTGAATGGGCTAAAAAACAAG
CGGTTAATTTACCCGCGAGTACAGCTGAAGCATTAACTGCTTATGTATCA
GTCCCACAAGATTGCAGTGATTTAAATGAGTATTTACGTTGTTTTGACTT
GCCACTTTCTTTATTGCAAACACCAGAAGCATTGAGCTCAGCCGTTACGG
ATTTAATTCAACGTTTAGATCAAGATGGTTTAGTCTATGCAGAAATTCGT
TTTGCTCCACAACTACATACACAACGATCAATGTCACAAGAAGATGCGGT
TAAAGCCGCATTACGTGGCTTACAAGCGGGCTTGGCTAGCACAAGTTTGT
TTAAAGCAAATTTGATTTTATGTTGTATGCGTGCGGCAGATAATAGATCA
GCAAATTTAGAAACAATTTGCTTGGCTAAACAGTATTTAACTAAATATGA
AGCTGGCGTGGTCGCGATTGATTTAGCCGGTGCAGAAGGATTGTTTGCTA
CTCAACATTTTCAGCAAGAGTTTGATTTTGCTAATCAACGTGGTGTGCCA
TTTACCATTCATGCAGGCGAAGCTGCCGGTCCAGAAAGTGTCCAACAAGC
GCTAGATTTTGGCGCTACTCGCATTGGTCACGGGATTCGGGCTATTGAAA
GCGAAACGGTAATGAAGCAATTAATTGATAAAAGAACGCCGCTAGAAATG
TGTCCTTGCAGTAATTTGCAAACTAAAACAGTCGCACAATTAGCAGACTA
CCCATTACGTACTTTTTTAATGCGTGGCGTAGTAGCCACTTTAAATACTG
ATAATATGACCGTTTCACAAACCTGTATTCAGCAAGAATACCGTTTATTG
GCTGAACAATATCAGCTGTCAATCTCAGAAGCAAAACAGCTACTATTAAA
TAGTATAGCGGCCGCTTTTTTATCAAATGAAGATAAAAAAGCCTTGTTAG
CGCATATTCAACAACGTTACCCTCAGCTCATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy