Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR271 IGR272 IGR268 IGR274 IGR270 IGR273 IGR269 IGR275 orfG, - HD0378 HD0376 ansB, - HD0372 HD0374 HD0375 add, - HD0377 nqrA, - HD0379 HD0371 pyrG, - HD0373 orfG, - HD0378 HD0376 ansB, - HD0372 HD0374 HD0375 add, - HD0377 nqrA, - HD0379 HD0371 pyrG, - HD0373 orfG, - HD0378 HD0376 ansB, - HD0372 HD0374 HD0375 add, - HD0377 nqrA, - HD0379 HD0371 pyrG, - HD0373
* Calculated from Protein Sequence

Gene ID: HD0375

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (probable glycosyltransferase)

Gene Start:
294324

Gene Stop:
295124

Gene Length:
801

Molecular Weight*:
30327

pI*:
4.80

Net Charge*:
-8.13

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1 to 111 are 36% ( EScore : 4e-13 ) identical to ref|NP_048459.1|| A111R >7461257|pir||T17601 hypothetical protein A111R - Chlorella virus PBCV-1 >1131455|gb|AAC96479.1| between residues 255 and 369 in [Paramecium bursaria Chlorella virus 1]
Residues 4 to 126 are 29% ( EScore : 2e-06 ) identical to gb|AAD45551.1|U70376_16 SpcF between residues 9 and 137 in [Streptomyces flavopersicus]
Residues 4 to 183 are 25% ( EScore : 9e-06 ) identical to gb|AAD28487.1|AF145038_1 glycosyltransferase between residues 14 and 204 in [Streptomyces spectabilis]

COGS Summary:  COGS Search
BeTs to 6 clades of COG0463
COG name: Glycosyltransferases involved in cell wall biogenesis
Functional Class: M
The phylogenetic pattern of COG0463 is AMTKYQVCEBRHujGPo---X
Number of proteins in this genome belonging to this COG is 5

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-111 are 36% similar to a (SEQUENCE GENOME) protein domain (PD214938) which is seen in Q84432_CHVP1.



Paralogs:  Local Blast Search
HD0375 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 187 (E-value = 3.4e-05) place HD0375 in the Glycos_transf_2 family which is described as Glycosyl transferase (PF00535)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLTKSVAVITSTIGRPELERAIQSVQQQTYPCQHYVFVDGVQFAEQAKQI
LDKYPQVIVTYLPMNTGANGWSNSSINAIAPFLAKEDMICYLDDDNWYEP
NHVETCLTCLMQNQLDYVYSYRNLINSVNNHFICRDTFESVGPNKALKLD
ISSNMLNIAGSIQLHNENHIDTNTYFLTRKVALEASQYWYSGRSNDNNVS
NWLLFSAYKGICTKTYSVNYLFDPTTFFNTFYQMICQNTPLNSSEQDKIA
ILEALIRAISDSQASD$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTAACGAAAAGTGTCGCAGTTATCACCTCCACCATTGGTCGCCCAGA
GTTAGAAAGAGCTATTCAATCAGTACAGCAACAGACCTATCCCTGTCAGC
ATTATGTATTTGTTGATGGTGTGCAGTTTGCTGAGCAAGCAAAGCAAATT
TTAGATAAATATCCACAAGTAATTGTTACTTATCTCCCGATGAATACCGG
TGCAAATGGTTGGTCGAATAGCAGTATTAATGCGATAGCGCCTTTTTTAG
CCAAAGAGGATATGATTTGCTATCTTGATGATGATAATTGGTATGAGCCA
AATCACGTAGAGACTTGTTTAACCTGCCTGATGCAAAATCAGTTAGACTA
TGTTTATAGTTATCGTAACTTAATTAATTCAGTGAATAATCATTTTATTT
GCCGGGATACGTTTGAATCTGTTGGACCTAATAAAGCCTTAAAATTAGAC
ATAAGCTCAAATATGTTGAATATTGCTGGCAGTATTCAACTTCATAATGA
AAATCATATTGATACTAATACCTATTTTTTAACCAGAAAAGTGGCGCTTG
AAGCCAGTCAATATTGGTATTCTGGTCGTTCAAATGATAATAATGTATCA
AATTGGTTATTGTTTTCTGCCTATAAAGGTATTTGTACTAAAACCTATAG
CGTGAATTATCTTTTTGATCCAACAACGTTTTTTAATACGTTTTATCAAA
TGATTTGCCAAAATACACCGCTCAATAGTAGTGAACAAGACAAAATAGCG
ATCTTAGAAGCATTAATTCGTGCAATTAGTGATAGTCAAGCGAGTGATTA
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy