Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR266 IGR271 IGR267 IGR272 IGR268 IGR274 IGR270 IGR273 IGR269 orfG, - HD0378 HD0376 ansB, - HD0372 HD0374 luxS, - HD0370 HD0375 add, - HD0377 HD0371 pyrG, - HD0373 pqiB, - HD0369 orfG, - HD0378 HD0376 ansB, - HD0372 HD0374 luxS, - HD0370 HD0375 add, - HD0377 HD0371 pyrG, - HD0373 pqiB, - HD0369 orfG, - HD0378 HD0376 ansB, - HD0372 HD0374 luxS, - HD0370 HD0375 add, - HD0377 HD0371 pyrG, - HD0373 pqiB, - HD0369
* Calculated from Protein Sequence

Gene ID: HD0373

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pyrG  

Definition:
CTP synthase

Gene Start:
292033

Gene Stop:
293670

Gene Length:
1638

Molecular Weight*:
59843

pI*:
5.90

Net Charge*:
-8.39

EC:
6.3.4.2  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Nucleotide and nucleoside interconversions  
Purines, pyrimidines, nucleosides, and nucleotides; Pyrimidine ribonucleotide biosynthesis  

Pathway: pathway table
Pyrimidine metabolism

Secondary Evidence:
Meng Q, Switzer RL.
Regulation of transcription of the Bacillus subtilis pyrG gene, encoding cytidine triphosphate synthetase.
J Bacteriol. 2001 Oct;183(19):5513-22.
PMID: 11544212

Wadskov-Hansen SL, Willemoes M, Martinussen J, Hammer K, Neuhard J, Larsen S.

Cloning and verification of the Lactococcus lactis pyrG gene and characterization of the gene product, CTP synthase.
J Biol Chem. 2001 Oct 12;276(41):38002-9.
PMID: 11500486

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 1 to 538 are 84% ( EScore : 0.0 ) identical to sp|P44341|PYRG_HAEIN CTP SYNTHASE between residues 8 and 543 in [Haemophilus influenzae Rd]
Residues 1 to 533 are 77% ( EScore : 0.0 ) identical to gb|AAF95590.1| (AE004315) CTP synthase between residues 8 and 540 in [Vibrio cholerae]
Residues 1 to 533 are 76% ( EScore : 0.0 ) identical to sp|P08398|PYRG_ECOLI CTP SYNTHASE between residues 8 and 540 in [Escherichia coli]
Residues 1 to 533 are 76% ( EScore : 0.0 ) identical to gb|AAA24485.1| (M12843) CTP synthetase between residues 8 and 540 in [Escherichia coli]
Residues 1 to 529 are 63% ( EScore : 0.0 ) identical to emb|CAB84970.1| (AL162757) CTP synthase between residues 7 and 538 in [Neisseria meningitidis]
Residues 1 to 529 are 63% ( EScore : 0.0 ) identical to gb|AAF41908.1| (AE002505) CTP synthase between residues 7 and 538 in [Neisseria meningitidis MC58]
Residues 1 to 531 are 60% ( EScore : 0.0 ) identical to gb|AAF84097.1|AE003962_7 CTP synthetase between residues 7 and 541 in [Xylella fastidiosa]
Residues 35 to 532 are 61% ( EScore : 0.0 ) identical to gb|AAC33441.1| (AF061753) CTP synthase between residues 1 and 500 in [Nitrosomonas europaea]
Residues 1 to 529 are 57% ( EScore : 1e-176 ) identical to sp|P13242|PYRG_BACSU CTP SYNTHASE between residues 7 and 528 in [Bacillus subtilis]
Residues 1 to 529 are 54% ( EScore : 1e-163 ) identical to sp|P28595|PYRG_AZOBR CTP SYNTHASE between residues 7 and 537 in [Azospirillum brasilense]

COGS Summary:  COGS Search
BeTs to 16 clades of COG0504
COG name: CTP synthase (UTP-ammonia lyase)
Functional Class:  F
The phylogenetic pattern of COG0504 is amtkYqvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB000991 (Glutamine amidotransferase class-I) with a combined E-value of 4.2e-09.
    IPB000991A    374-383
    IPB000991B    509-519


ProDom Summary:  Protein Domain Search
Residues 8-334 are 86% similar to a (CTP LIGASE SYNTHASE SYNTHETASE) protein domain (PD002309) which is seen in PYRG_HAEIN.

Residues 326-535 are 27% similar to a (TRANSFERASE PROTEOME PA2268 COMPLETE) protein domain (PD415969) which is seen in Q9L211_STRCO.

Residues 434-537 are 85% similar to a (CTP LIGASE SYNTHASE SYNTHETASE) protein domain (PD002477) which is seen in Q9CJW9_PASMU.

Residues 385-433 are 77% similar to a (CTP LIGASE SYNTHASE BIOSYNTHESIS) protein domain (PD346505) which is seen in PYRG_HAEIN.

Residues 341-405 are 80% similar to a (CTP AMIDOTRANSFERASE LIGASE BIOSYNTHESIS) protein domain (PD137961) which is seen in Q9HXZ4_PSEAE.



Paralogs:  Local Blast Search

HD0373 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 3 to 278 (E-value = 2.9e-213) place HD0373 in the CTP_synth_N family which is described as CTP synthase N-terminus (PF06418)
Residues 300 to 535 (E-value = 9.6e-74) place HD0373 in the GATase family which is described as Glutamine amidotransferase class-I (PF00117)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MATNYIFVTGGVVSSLGKGIAAASLASILEARGLNVTIMKLDPYINVDPG
TMSPTQHGEVFVTQDGAETDLDLGHYERFIRSKMSKANNFTSGKIYSEVL
RKERRGDYLGATIQVIPHITNEIKARVIEGGKGRDVVIVEVGGTVGDIES
LPFLEALRQLAVDVGREKTLFMHLTLVPYIPTAGEVKTKPTQHSVKELLS
IGIQPDVLICRSDRTIPANERKKIALFCNVPERAVISLKDVDSIYRIPEL
LKSQALDSFVCDRFRLECPEADLSEWEQVLYRQANPTGEVTIGMVGKYVE
LPDAYKSVNEALKHAGLTSRLSVNIKYIDSQDIETKGTELLDGLDAILVP
GGFGYRGVEGKIRTAQYARENNIPYLGICLGMQIALIEYARNVAGLTEAN
SSEFDPACSQPVIGLITEWQDESGNVETRTDKSDLGGTMRLGAQQCHLIE
GTKAREIYGAEAIVERHRHRYEVNNVLLPTIEAAGLKVSGVSADRKLVEI
IEVPNHPWFIAAQFHPEFTSTPRDGHPLFAGFVAAAKAYQDSRKA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAACGAATTATATTTTCGTGACGGGCGGTGTTGTTTCATCTTTAGG
CAAAGGTATTGCCGCGGCATCACTCGCATCTATTCTTGAAGCTCGTGGTT
TAAATGTTACCATTATGAAGCTTGATCCTTATATTAATGTCGATCCAGGC
ACTATGAGTCCTACCCAACACGGTGAGGTTTTTGTTACTCAAGATGGTGC
GGAAACTGATTTAGATTTAGGCCATTATGAACGTTTTATTCGCTCAAAAA
TGAGTAAAGCAAATAATTTTACTAGCGGTAAGATTTATTCAGAAGTATTA
CGTAAAGAACGGCGTGGTGATTATCTCGGTGCGACAATTCAAGTGATTCC
GCATATTACTAATGAAATTAAAGCGCGTGTAATTGAAGGTGGTAAAGGTC
GCGATGTTGTGATTGTGGAAGTGGGGGGCACTGTTGGCGATATTGAGTCC
TTACCATTCTTAGAAGCATTACGTCAGCTTGCTGTAGATGTAGGCCGTGA
AAAAACATTGTTTATGCATTTAACGTTAGTGCCATATATTCCAACAGCGG
GTGAAGTCAAAACTAAACCAACGCAACATTCCGTGAAAGAATTACTGTCA
ATTGGTATTCAACCAGACGTGTTAATCTGTCGTTCAGACCGTACAATTCC
TGCAAATGAACGTAAAAAAATTGCTTTATTCTGTAATGTGCCAGAACGTG
CAGTGATTTCATTAAAAGATGTTGATTCGATTTACCGTATTCCAGAATTA
TTAAAATCACAAGCTTTAGATAGTTTTGTTTGTGATCGCTTCCGTTTGGA
ATGCCCAGAAGCAGATTTAAGTGAATGGGAACAAGTGCTTTATCGTCAAG
CAAATCCAACCGGTGAAGTGACCATTGGAATGGTCGGCAAATATGTTGAA
TTACCCGATGCGTATAAATCGGTGAATGAAGCATTAAAACACGCCGGTTT
AACCAGCCGCTTAAGTGTTAATATTAAATATATTGATTCACAAGATATTG
AAACAAAAGGCACAGAATTATTAGATGGCTTAGATGCGATTTTAGTCCCA
GGTGGTTTTGGTTATCGTGGCGTGGAAGGTAAGATCCGTACAGCGCAATA
TGCAAGAGAAAATAATATTCCTTATTTAGGTATTTGTTTAGGTATGCAGA
TTGCATTAATTGAATATGCGCGTAATGTAGCGGGCTTAACTGAGGCAAAT
TCATCGGAATTTGATCCTGCGTGTAGCCAGCCAGTGATTGGTTTAATTAC
GGAATGGCAAGATGAATCAGGCAATGTTGAAACACGTACAGATAAATCAG
ATTTAGGTGGTACAATGCGTTTAGGTGCACAGCAATGCCATTTAATTGAA
GGAACTAAAGCTCGAGAAATCTATGGCGCAGAAGCGATTGTTGAACGTCA
TCGCCACCGCTATGAAGTGAATAATGTATTATTGCCAACTATTGAAGCGG
CGGGATTAAAGGTAAGCGGTGTCTCAGCGGATCGCAAATTAGTTGAAATT
ATTGAAGTGCCAAACCATCCTTGGTTTATCGCTGCTCAATTTCATCCAGA
ATTTACTTCGACTCCTCGTGATGGGCATCCATTATTTGCAGGTTTTGTTG
CCGCAGCAAAAGCATATCAAGATTCGCGTAAAGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy