Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR264 IGR257 IGR261 IGR266 IGR267 IGR260 IGR262 IGR259 IGR258 IGR265 IGR263 IGR256 HD0359 HD0358 asd,usg, - HD0363 HD0362 infA, - HD0361 HD0365 ybaK, - HD0364 luxS, - HD0370 fldA, - HD0366 HD0360 HD0371 pqiB, - HD0369 HD0359 HD0358 asd,usg, - HD0363 HD0362 infA, - HD0361 HD0365 ybaK, - HD0364 luxS, - HD0370 fldA, - HD0366 HD0360 HD0371 pqiB, - HD0369 HD0358 asd,usg, - HD0363 HD0362 HD0359 infA, - HD0361 ybaK, - HD0364 fldA, - HD0366 HD0360 HD0371 pqiB, - HD0369 fur, - HD0367 fur, - HD0367 HD0365 luxS, - HD0370
* Calculated from Protein Sequence

Gene ID: HD0365

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
284214

Gene Stop:
284510

Gene Length:
297

Molecular Weight*:
11235

pI*:
10.70

Net Charge*:
6.18

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-89 are 73% similar to >15602219 unknown [Pasteurella multocida].

Residues 2 to 87 are 58% ( EScore : 2e-20 ) identical to sp|P75735|YBFE_ECOLI HYPOTHETICAL 13.9 KDA PROTEIN IN FLDA-SEQA INTERGENIC REGION >7459770|pir||D64803 ybfE protein >1786901|gb|AAC73779.1| between residues 22 and 107 in [Escherichia coli]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-84 are 75% similar to a (PROTEOME PM0354 COMPLETE FLDA-SEQA) protein domain (PD413973) which is seen in Q9CNS1_PASMU.



Paralogs:  Local Blast Search
HD0365 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAKQDADCITLDLFASMPKVGRPRTNPLSREQQVRINKRNQLKRDRSSGL
KRVELKLHSDLVLSLEKEASQLGMTRGQLIEMILNNYINSNTIDSERK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCAAAACAAGACGCAGATTGTATAACTTTAGATTTGTTCGCAAGCAT
GCCAAAAGTTGGGCGACCACGCACTAATCCTCTTAGCCGAGAACAACAAG
TCAGAATTAATAAACGTAATCAGCTAAAACGAGATCGGTCGTCAGGGCTT
AAACGCGTTGAATTAAAACTGCATTCAGATCTGGTGTTATCTTTGGAAAA
AGAGGCTTCCCAACTCGGAATGACACGAGGGCAGTTAATCGAAATGATTT
TAAATAATTATATCAATAGCAATACTATTGATTCAGAGCGCAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy