Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR264 IGR257 IGR261 IGR260 IGR262 IGR259 IGR258 IGR265 IGR263 IGR256 HD0359 HD0358 asd,usg, - HD0363 HD0362 cstA, - HD0357 infA, - HD0361 HD0365 ybaK, - HD0364 fldA, - HD0366 HD0360 pqiB, - HD0369 HD0359 HD0358 asd,usg, - HD0363 HD0362 cstA, - HD0357 infA, - HD0361 HD0365 ybaK, - HD0364 fldA, - HD0366 HD0360 pqiB, - HD0369 HD0358 asd,usg, - HD0363 HD0362 cstA, - HD0357 HD0359 infA, - HD0361 ybaK, - HD0364 fldA, - HD0366 HD0360 pqiB, - HD0369 fur, - HD0367 fur, - HD0367 HD0365
* Calculated from Protein Sequence

Gene ID: HD0363

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
asd  usg  

Definition:
aspartate semialdehyde dehydrogenase/USG-1 protein

Gene Start:
283433

Gene Stop:
282447

Gene Length:
987

Molecular Weight*:
36288

pI*:
4.60

Net Charge*:
-16.91

EC:
1.2.1.11  

Functional Class:
Amino acid biosynthesis; Aspartate family  
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycine, serine and threonine metabolism
Lysine biosynthesis

Secondary Evidence:
Arps,P.J. and Winkler,M.E.
Structural analysis of the Escherichia coli K-12 hisT operon by
using a kanamycin resistance cassette
J. Bacteriol. 169 (3), 1061-1070 (1987)
MEDLINE: 87137258

Karsten,W.E. and Viola,R.E.
Identification of an essential cysteine in the reaction catalyzed
by aspartate-beta-semialdehyde dehydrogenase from Escherichia coli
Biochim. Biophys. Acta 1121 (1-2), 234-238 (1992)
MEDLINE: 92287957

Hadfield,A., Kryger,G., Ouyang,J., Petsko,G.A., Ringe,D. and
Viola,R.
Structure of aspartate-beta-semialdehyde dehydrogenase from
Escherichia coli, a key enzyme in the aspartate family of amino
acid biosynthesis
J. Mol. Biol. 289 (4), 991-1002 (1999)
MEDLINE: 99299393




Comment:
0

Blast Summary:  PSI-Blast Search
Residues 4 to 321 are 45% ( EScore : 5e-70 ) identical to sp|P45201|USG_HAEIN USG-1 PROTEIN HOMOLOG >1074202|pir||B64123 probable dehydrogenase between residues 5 and 308 in [Haemophilus influenzae Rd]
Residues 13 to 321 are 32% ( EScore : 2e-35 ) identical to sp|P08390|USG_ECOLI USG-1 PROTEIN >76210|pir||QQECH3 probable dehydrogenase between residues 15 and 327 in [Escherichia coli]
Residues 13 to 328 are 27% ( EScore : 2e-22 ) identical to gb|AAF95253.1| (AE004284) aspartate-semialdehyde dehydrogenase, putative between residues 16 and 337 in [Vibrio cholerae]
Residues 13 to 328 are 27% ( EScore : 2e-22 ) identical to sp|P23247|DHAS_VIBCH between residues 15 and 336
Residues 13 to 328 are 27% ( EScore : 4e-22 ) identical to pir||S14523 aspartate-semialdehyde dehydrogenase between residues 15 and 336 in [Vibrio cholerae]
Residues 13 to 328 are 26% ( EScore : 4e-22 ) identical to emb|CAA75569.1| (Y15281) aspartate-semialdehyde dehydrogenase between residues 15 and 336 in [Vibrio cholerae]
Residues 13 to 308 are 26% ( EScore : 6e-21 ) identical to gb|AAC43371.1| (U25082) aspartate-semialdehyde dehydrogenase [Vibrio cholerae] >882379|gb|AAC43372.1| between residues 15 and 315 in [Vibrio cholerae]
Residues 13 to 308 are 26% ( EScore : 6e-21 ) identical to gb|AAC43355.1| (U25065) aspartate-semialdehyde dehydrogenase [Vibrio cholerae] >882349|gb|AAC43357.1| between residues 15 and 315 in [Vibrio cholerae]
Residues 13 to 308 are 26% ( EScore : 6e-21 ) identical to gb|AAC43359.1| (U25070) aspartate-semialdehyde dehydrogenase between residues 15 and 315 in [Vibrio cholerae]
Residues 13 to 308 are 26% ( EScore : 8e-21 ) identical to gb|AAC43358.1| (U25069) aspartate-semialdehyde dehydrogenase between residues 15 and 315 in [Vibrio cholerae]

COGS Summary:  COGS Search
BeTs to 10 clades of COG0136
COG name: Aspartate-semialdehyde dehydrogenase
Functional Class:  E
The phylogenetic pattern of COG0136 is amtkyqvcEbrHuj----inx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 120-312 are 33% similar to a (DEHYDROGENASE BIOSYNTHESIS) protein domain (PD002095) which is seen in USG_ECOLI.

Residues 4-324 are 44% similar to a (PROTEOME COMPLETE USG1 USG-1) protein domain (PD131454) which is seen in Q9CNE6_PASMU.



Paralogs:  Local Blast Search
HD0363 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSEIHLAIATDFSLASKLLEALEKSDLPLKHISAVEIEPFGEEQSLYSGS
KAIEQIPLAEVNWAKFSHVFFAGNMSQAEVLAEAVKAGCIVLDLYGITAL
IDNIPVIVPSVNDETMAQLREHNIVALANPQISQLALALKPFLNQPISHV
LVSSLLPAAYFGDEKVKQLAGQTARLLNGIPFDENAERIAFDAVPANIQA
EEKKLPFSRVFELQLAKILPNLSACATFHAIQIPIFYGVAQMVTVHSEYP
LAIEAISDQWQQQAWLNFHEQQVITPVKNGENEEENNLQISQLLSKSDHT
AQFWSVADEQKFSLAFLAVQLFRLALDY$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTCAGAGATCCATTTAGCCATTGCAACAGATTTTAGCTTAGCTTCCAA
GTTACTTGAAGCATTAGAAAAGAGTGATTTGCCTTTAAAACATATTTCTG
CTGTAGAAATTGAACCCTTTGGCGAAGAGCAATCACTTTATAGCGGAAGC
AAAGCAATTGAACAAATTCCGTTAGCCGAAGTGAATTGGGCTAAATTTAG
CCATGTATTTTTTGCAGGAAATATGTCACAAGCAGAAGTGCTTGCAGAAG
CAGTAAAAGCGGGCTGTATTGTACTTGATTTATACGGCATTACTGCTTTA
ATCGATAATATTCCGGTTATTGTGCCAAGTGTTAATGATGAGACGATGGC
TCAATTACGTGAACATAATATTGTTGCCTTAGCCAACCCGCAAATTTCAC
AATTAGCATTGGCATTAAAACCATTCCTCAATCAACCTATTAGCCATGTT
TTAGTCAGTTCATTACTCCCTGCCGCTTATTTTGGCGATGAAAAAGTTAA
ACAATTAGCCGGTCAAACTGCCCGCTTATTAAATGGCATCCCATTTGATG
AAAATGCAGAACGGATTGCTTTTGATGCCGTGCCCGCAAATATTCAAGCA
GAGGAGAAAAAATTACCTTTCTCACGTGTTTTTGAATTACAACTTGCCAA
AATATTGCCTAATTTGAGCGCTTGTGCAACATTCCACGCCATTCAAATAC
CCATATTTTATGGGGTAGCACAAATGGTTACCGTGCATTCTGAATATCCA
TTAGCAATCGAAGCGATCAGCGATCAGTGGCAACAACAAGCTTGGTTAAA
CTTCCACGAACAACAGGTGATCACACCGGTTAAAAACGGTGAAAATGAAG
AAGAAAATAACTTACAAATCAGCCAATTACTCTCTAAATCAGACCACACG
GCACAATTTTGGTCCGTCGCCGATGAACAAAAATTTAGCTTAGCATTCCT
TGCGGTGCAATTATTTAGATTAGCGCTAGATTATTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy