Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR257 IGR252 IGR255 IGR254 IGR260 IGR259 IGR251 IGR258 IGR253 IGR250 IGR256 HD0359 HD0358 yjjV, - HD0356 HD0362 cstA, - HD0357 HD0352 infA, - HD0361 HD0360 htpX, - HD0353 nrfD, - HD0350 gor, - HD0354 prfC, - HD0351 HD0359 HD0358 yjjV, - HD0356 HD0362 cstA, - HD0357 HD0352 infA, - HD0361 HD0360 htpX, - HD0353 nrfD, - HD0350 gor, - HD0354 prfC, - HD0351 HD0358 yjjV, - HD0356 HD0362 cstA, - HD0357 HD0359 HD0352 infA, - HD0361 HD0360 htpX, - HD0353 nrfD, - HD0350 gor, - HD0354 prfC, - HD0351
* Calculated from Protein Sequence

Gene ID: HD0356

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
yjjV  

Definition:
possible deoxyribonuclease

Gene Start:
277402

Gene Stop:
276602

Gene Length:
801

Molecular Weight*:
29879

pI*:
8.80

Net Charge*:
5.02

EC:
3.1.21.-  

Functional Class:
Unassigned  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Significant hits in gapped BLAST to conserved hypothetical protein sequences and few significant hits to deoxyribonuclease sequences, e.g.residues 1-261 are 57% similar to deoxyribonuclease in Haemophilus influenzae (1176482|).

Residues 4-261 are 42% similar to conserved hypothetical protein in Vibrio cholerae (15642350|).

COGS Summary:  COGS Search
BeTs to 16 clades of COG0084
COG name: Predicted hydrolases of PHP superfamily
Functional Class: R
The phylogenetic pattern of COG0084 is -mtkYqvcEbrHujgpoLinx
Number of proteins in this genome belonging to this COG is 3

Blocks Summary:  Blocks Search
***** IPB001130 (Uncharacterized protein family UPF0006) with a combined E-value of 2.4e-28.
    IPB001130A    3-11
    IPB001130B    60-68
    IPB001130C    93-103
    IPB001130D    117-140
    IPB001130E    202-222


ProDom Summary:  Protein Domain Search
Residues 1-151 are 43% similar to a (COMPLETE PROTEOME HYDROLASE 3.1.21.-) protein domain (PD002155) which is seen in Q9CM93_PASMU.

Residues 159-214 are 80% similar to a (PROTEOME COMPLETE DEOXYRIBONUCLEASE 3.1.21.- HYDROLASE) protein domain (PD403160) which is seen in YJJV_HAEIN.

Residues 215-261 are 68% similar to a (NUCLEASE HYDROLASE DEOXYRIBONUCLEASE) protein domain (PD405930) which is seen in Q9CM93_PASMU.



Paralogs:  Local Blast Search
HD0356 is paralogously related to HD1936 (1e-24) and HD0570 (4e-10).


Pfam Summary:  Pfam Search
Residues 1 to 263 (E-value = 6.7e-70) place HD0356 in the TatD_DNase family which is described as TatD related DNase (PF01026)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLFFDTHTHLDYLADQLELPFSQLINQATKAQVKRLMLVAVSAKNFAKIT
AYAQQYPQHLVYGLGLHPLYIAQHQYTDLDLLANHLAKQDRQCTAIAEIG
LDKGIATIATTAMWYKQCEFLEAQLALAKQANLAVSLHSRNTHDQLAVLL
KKNPLTKTGVIHAFSGSYQQAKRFIELGYKIGVGGIITYTRANKTRNTIS
KLPLDSLVLETDSPDMPVFGYQGQANQPERIKLIFEALCQLRSESAEQIS
QTIWQTSEKLFWPSLS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTATTTTTCGACACTCATACCCATTTAGACTATTTAGCGGATCAACT
TGAGCTTCCCTTTAGTCAACTTATTAACCAAGCGACAAAAGCTCAAGTTA
AACGTTTAATGCTGGTCGCAGTATCTGCCAAAAATTTTGCAAAAATAACC
GCTTATGCACAACAATACCCTCAGCATCTAGTTTACGGTTTAGGCTTACA
TCCACTCTATATTGCACAACATCAATATACCGATTTAGATTTACTCGCGA
ACCACTTAGCAAAACAAGACAGACAATGCACCGCGATTGCAGAAATTGGA
CTTGATAAAGGCATAGCAACAATTGCGACCACCGCAATGTGGTATAAACA
ATGTGAATTCTTAGAAGCACAGCTTGCGCTCGCCAAACAAGCAAACTTAG
CGGTAAGTTTACATTCACGTAACACGCATGATCAGCTCGCTGTTTTACTC
AAAAAAAATCCATTAACTAAAACAGGGGTCATTCATGCTTTTAGCGGTAG
CTATCAACAAGCTAAACGCTTTATTGAATTAGGCTATAAAATAGGGGTCG
GTGGCATTATCACTTATACGCGCGCCAACAAAACTCGCAACACGATCAGT
AAATTACCATTAGACAGTTTAGTCTTAGAAACAGATTCACCGGATATGCC
CGTTTTTGGCTACCAAGGGCAAGCTAACCAACCTGAACGAATCAAACTGA
TTTTTGAGGCTCTTTGTCAATTACGTTCTGAATCCGCTGAACAAATTAGC
CAAACGATTTGGCAAACCAGTGAAAAACTCTTTTGGCCGAGCTTATCTTG
A


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy