Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR252 IGR249 IGR255 IGR254 IGR251 IGR253 IGR250 IGR256 HD0358 yjjV, - HD0356 cstA, - HD0357 HD0352 nrfB, - HD0347 nrfC,fdoH, - HD0349 htpX, - HD0353 nrfD, - HD0350 gor, - HD0354 nrfA, - HD0344 prfC, - HD0351 HD0358 yjjV, - HD0356 cstA, - HD0357 HD0352 nrfB, - HD0347 nrfC,fdoH, - HD0349 htpX, - HD0353 nrfD, - HD0350 gor, - HD0354 nrfA, - HD0344 prfC, - HD0351 HD0358 yjjV, - HD0356 cstA, - HD0357 HD0352 nrfC,fdoH, - HD0349 htpX, - HD0353 nrfD, - HD0350 gor, - HD0354 nrfA, - HD0344 prfC, - HD0351 nrfB, - HD0347
* Calculated from Protein Sequence

Gene ID: HD0353

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
htpX  

Definition:
heat shock protein htpX/possible protease

Gene Start:
274112

Gene Stop:
274999

Gene Length:
888

Molecular Weight*:
32602

pI*:
7.10

Net Charge*:
0.35

EC:
3.4.24.-  

Functional Class:
Cellular processes; Chaperones  
Other categories; Adaptations and atypical conditions  
Translation; Degradation of proteins, peptides, and glycopeptides  

Pathway: pathway table

Secondary Evidence:
Shimohata N, Chiba S, Saikawa N, Ito K, Akiyama Y.
The Cpx stress response system of Escherichia coli senses plasma membrane proteins and controls HtpX, a membrane protease
with a cytosolic active site.
Genes Cells. 2002 Jul;7(7):653-62.
PMID: 12081643

Vickerman MM, Mather NM, Minick PE, Edwards CA.
Initial characterization of the Streptococcus gordonii htpX gene.
Oral Microbiol Immunol. 2002 Feb;17(1):22-31.
PMID: 11860552

Kornitzer D, Teff D, Altuvia S, Oppenheim AB.
Isolation, characterization, and sequence of an Escherichia coli heat shock gene, htpX.
J Bacteriol. 1991 May;173(9):2944-53.
PMID: 1826904

Comment:


Blast Summary:  PSI-Blast Search
Residues 10 to 295 are 69% ( EScore : 1e-108 ) identical to sp|P44840|HTPX_HAEIN PROBABLE PROTEASE HTPX >1074178|pir||H64088 heat shock protein htpX between residues 3 and 283 in [Haemophilus influenzae Rd]
Residues 10 to 293 are 57% ( EScore : 6e-86 ) identical to sp|P23894|HTPX_ECOLI PROBABLE PROTEASE HTPX between residues 3 and 287 in [Escherichia coli]
Residues 7 to 293 are 48% ( EScore : 2e-70 ) identical to gb|AAF85422.1|AE004069_3 heat shock protein between residues 1 and 285 in [Xylella fastidiosa]
Residues 9 to 295 are 48% ( EScore : 5e-69 ) identical to gb|AAF41235.1| (AE002435) heat shock protein HtpX between residues 70 and 347 in [Neisseria meningitidis MC58]
Residues 9 to 295 are 48% ( EScore : 5e-69 ) identical to emb|CAB84300.1| (AL162754) putative membrane-bound zinc metallopeptidase between residues 2 and 279 in [Neisseria meningitidis]
Residues 7 to 292 are 39% ( EScore : 5e-51 ) identical to sp|O31657|HTPX_BACSU PROBABLE PROTEASE HTPX HOMOLOG >7428777|pir||G69862 heat-shock protein homolog ykrL - Bacillus subtilis >2633720|emb|CAB13222.1| between residues 1 and 295 in [Bacillus subtilis]
Residues 13 to 295 are 27% ( EScore : 3e-20 ) identical to sp|O58997|HTPX_PYRHO PROBABLE PROTEASE HTPX HOMOLOG >7441958|pir||C71070 probable heat shock protein - Pyrococcus horikoshii >3257674|dbj|BAA30357.1| between residues 8 and 284 in [Pyrococcus horikoshii]
Residues 13 to 295 are 26% ( EScore : 2e-19 ) identical to pir||A75094 heat shock protein between residues 5 and 281 in [Pyrococcus abyssi]
Residues 48 to 292 are 27% ( EScore : 1e-17 ) identical to sp|Q59076|HTPX_METJA PROBABLE PROTEASE HTPX HOMOLOG >2127959|pir||H64509 heat shock protein X - Methanococcus jannaschii >1592249|gb|AAB99703.1| between residues 30 and 275 in [Methanococcus jannaschii]
Residues 9 to 295 are 24% ( EScore : 5e-17 ) identical to sp|O30795|HTPX_STRGC PUTATIVE HEAT SHOCK PROTEIN HTPX >2407215|gb|AAB70525.1| between residues 11 and 297 in [Streptococcus gordonii]

COGS Summary:  COGS Search
BeTs to 10 clades of COG0501
COG name: Predicted Zn-dependent proteases (possible chaperone function)
Functional Class: O
The phylogenetic pattern of COG0501 is AmTKYQ-CEBRhUJ-------
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 10-65 are 64% similar to a (COMPLETE HYDROLASE HEAT SHOCK) protein domain (PD270759) which is seen in HTPX_HAEIN.

Residues 76-142 are 65% similar to a (COMPLETE PROTEOME PROTEASE) protein domain (PD002296) which is seen in HTPX_ECOLI.

Residues 157-295 are 71% similar to a (ZINC HYDROLASE 3.4.24.- METALLOPROTEASE) protein domain (PD261187) which is seen in HTPX_HAEIN.

Residues 66-105 are 75% similar to a (PROTEASE METALLOPROTEASE 3.4.24.- ZINC) protein domain (PD405467) which is seen in HTPX_HAEIN.



Paralogs:  Local Blast Search
HD0353 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 88 (E-value = 1.2e-41) place HD0353 in the HtpX_N family which is described as HtpX N-terminus (PF06509)
Residues 89 to 295 (E-value = 7.3e-46) place HD0353 in the Peptidase_M48 family which is described as Peptidase family M48 (PF01435)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LELCFCMSKRVILFLLTNLAITFVLGIVLNIIFQVTGIKGTSTTGILMMS
LLFGFTGSLISLFMSKSMALRSVGAEVIQQPRNQAEQWLFNTVQRQSQKA
GIPMPDIAIYHSADVNAFATGATKNNSLVAVSTGLLDNMTEDEAEAVVAH
EIAHIANGDMVTMTLLQGVLNTFVIFLSRMISTAVSGSRDENGNSTQNTL
VFWVVDIALQMIFGILATMIAMWFSRYREYRADMGSAQLVGKEKMIAALE
RLRHVHEPQEMQGSLSAFMINGIRSKELFMSHPPLEKRIEALRNL$

Gene Nucleotide Sequence:  Sequence Viewer
TTGGAGCTTTGTTTTTGTATGTCAAAAAGAGTGATTTTATTTTTATTAAC
TAACTTAGCCATTACTTTTGTACTTGGTATCGTATTGAATATTATTTTTC
AAGTGACAGGTATTAAAGGCACAAGTACGACCGGTATTTTAATGATGTCT
TTGTTATTTGGTTTTACCGGATCGTTAATTTCGCTATTTATGTCAAAATC
GATGGCATTACGTTCTGTAGGCGCTGAAGTGATTCAACAACCGAGAAACC
AAGCAGAACAGTGGTTATTTAATACGGTGCAACGTCAATCACAAAAAGCA
GGTATTCCAATGCCAGATATTGCCATTTATCATTCTGCTGATGTCAATGC
GTTTGCAACGGGTGCGACTAAAAATAATTCTTTAGTCGCGGTGAGTACCG
GTCTGTTAGATAATATGACTGAAGATGAAGCTGAGGCGGTCGTAGCACAT
GAAATTGCGCATATTGCTAATGGTGATATGGTCACAATGACTTTATTGCA
AGGCGTGCTAAACACGTTTGTGATTTTTTTATCTAGAATGATTTCAACGG
CGGTTTCAGGCTCACGTGATGAAAATGGCAATTCAACTCAAAATACATTA
GTGTTTTGGGTAGTGGATATTGCACTACAAATGATTTTCGGCATATTAGC
GACAATGATTGCTATGTGGTTTTCACGTTATCGAGAATATCGTGCAGATA
TGGGCTCGGCACAATTAGTTGGCAAAGAGAAAATGATTGCCGCTTTAGAG
CGCCTAAGACATGTACACGAACCACAAGAAATGCAAGGTTCATTATCTGC
ATTTATGATCAATGGTATTCGTTCTAAAGAGTTGTTTATGAGTCATCCAC
CGCTTGAAAAGCGCATTGAAGCATTGAGAAATTTATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy