Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR246 IGR243 IGR249 IGR247 IGR251 IGR245 IGR244 IGR250 IGR248 HD0338 HD0343 HD0340 engB, - HD0342 rluC, - HD0337 HD0352 HD0339 nrfB, - HD0347 nrfC,fdoH, - HD0349 kdsB,kpsU, - HD0334 nrfD, - HD0350 nrfA, - HD0344 prfC, - HD0351 HD0338 HD0343 HD0340 engB, - HD0342 rluC, - HD0337 HD0352 HD0339 nrfB, - HD0347 nrfC,fdoH, - HD0349 kdsB,kpsU, - HD0334 nrfD, - HD0350 nrfA, - HD0344 prfC, - HD0351 HD0338 HD0343 HD0340 engB, - HD0342 rluC, - HD0337 HD0336 HD0336 HD0352 HD0339 nrfB, - HD0347 nrfC,fdoH, - HD0349 kdsB,kpsU, - HD0334 nrfD, - HD0350 nrfA, - HD0344 prfC, - HD0351
* Calculated from Protein Sequence

Gene ID: HD0344

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
nrfA  

Definition:
formate dependent nitrite reductase, cytochrome c552, nrfA

Gene Start:
268329

Gene Stop:
269807

Gene Length:
1479

Molecular Weight*:
55410

pI*:
7.20

Net Charge*:
1.58

EC:
1.7.-.-  

Functional Class:
Energy metabolism; Anaerobic respiration  

Pathway: pathway table

Primary Evidence:
NULL

Secondary Evidence:
Hussain,H., Grove,J., Griffiths,L., Busby,S. and Cole,J.
A seven-gene operon essential for formate-dependent nitrite
reduction to ammonia by enteric bacteria
Mol. Microbiol. 12 (1), 153-163 (1994)
MEDLINE: 94335626


Comment:
For other "nrf" genes, see HD0347 (nrfB), HD0615 (nrfE), HD0617 (nrfF), HD0619 (nrfF2), HD0059 (ccmH), HD0060 (ccmH).

Blast Summary:  PSI-Blast Search
Residues 3 to 440 are 66% ( EScore : 0.0 ) identical to sp|P45017|NRFA_HAEIN CYTOCHROME C552 PRECURSOR >1074096|pir||C64181 formate-dependent nitrite reductase between residues 75 and 531 in [Haemophilus influenzae Rd]
Residues 1 to 442 are 56% ( EScore : 1e-156 ) identical to sp|P32050|NRFA_ECOLI CYTOCHROME C552 PRECURSOR >541060|pir||S39590 formate-dependent nitrite reductase between residues 36 and 478 in [Escherichia coli]
Residues 4 to 448 are 46% ( EScore : 1e-115 ) identical to emb|CAB53160.1| (AJ245540) catalytic subunit of cytochrome c nitrite reductase between residues 47 and 495 in [Wolinella succinogenes]
Residues 7 to 450 are 45% ( EScore : 1e-112 ) identical to pdb|1QDB|A between residues 8 and 462
Residues 7 to 450 are 45% ( EScore : 1e-112 ) identical to emb|CAB37320.1| (AJ133037) cytochrome c nitrite reductase between residues 49 and 503 in [Sulfurospirillum deleyianum]
Residues 38 to 390 are 26% ( EScore : 8e-39 ) identical to emb|CAB73784.1| (AL139078) putative periplasmic cytochrome C between residues 96 and 542 in [Campylobacter jejuni]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 27-476 are 65% similar to a (CYTOCHROME PERIPLASMIC PRECURSOR SIGNAL) protein domain (PD043029) which is seen in NRFA_HAEIN.



Paralogs:  Local Blast Search


HD0344 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 27 to 476 (E-value = 1.2e-291) place HD0344 in the Cytochrom_C552 family which is described as Cytochrome c552 (PF02335)

PDB Hit:
pdb|1FS9|A Chain A, Cytochrome C Nitrite Reductase From Wolinel... 419 5e-118
pdb|1FS7|A Chain A, Cytochrome C Nitrite Reductase From Wolinel... 419 5e-118
pdb|1QDB|A Chain A, Cytochrome C Nitrite Reductase >gi|5822244|... 409 4e-115

Gene Protein Sequence:
ATIAMLGCLSVSAWAETPTNQPESLTDKALKHEKLGVVVESANHKFAEKY
RLQYDSWKATAESTDRSSALEADPRLVVLWAGYAFAKEYNKPRGHYYAVT
DVREILRTGAPKDENDGPQPMACWTCKGPDVPRLIEEKGERGYFDPKWAK
YGAEIVNSIGCADCHDTTSKAFEEGKPALRVARPHVLRALESVGWRFEDL
DKHGKRVAVCSNCHVEYYFKDKKDVTFPWAKGVDVDSIEKYYDESQFTDW
THALSKAPMLKTQHPDFEVWSQGVHGKNGVTCIDCHMPKVKDKDGKVYTE
HKIGNPFDRFDATCKTCHEQSKQTLQDRVKEHKAQVKEAMIRLEDQIVKA
HFEAKVAWDAGATAEEMQDILMAIRHAQWRWDYSAAGHGNHFHAPDVMLH
TIATGLDRVADARAKLGVVLTKHGVETPIVMPDISTREKAQKAVGIDIAK
DQAAKDEFLRTVVPQWERQARERGLLPEVTPKSVTTPKVDAK$

Gene Nucleotide Sequence:  Sequence Viewer
GCAACCATTGCAATGCTAGGCTGTTTATCGGTATCCGCTTGGGCTGAAAC
ACCAACTAATCAACCTGAGTCGTTAACAGATAAAGCCTTAAAACATGAAA
AATTAGGCGTGGTGGTAGAATCAGCTAATCATAAGTTTGCTGAAAAATAT
CGATTGCAATACGACTCTTGGAAAGCGACTGCTGAATCGACTGATCGTAG
TAGCGCATTAGAGGCTGATCCTCGTCTTGTCGTGTTATGGGCAGGTTATG
CATTTGCAAAAGAATATAATAAACCACGTGGCCATTATTATGCAGTCACT
GATGTGCGTGAAATTTTACGTACAGGCGCCCCTAAAGATGAAAATGATGG
TCCGCAACCAATGGCTTGTTGGACATGTAAAGGCCCTGATGTACCTCGCT
TAATTGAAGAAAAAGGCGAACGGGGTTATTTTGATCCTAAATGGGCAAAA
TATGGTGCAGAAATTGTTAATTCCATTGGTTGTGCTGACTGTCACGACAC
AACTTCAAAAGCGTTTGAAGAAGGGAAACCGGCGTTACGTGTTGCGCGTC
CTCATGTATTACGTGCATTAGAATCTGTAGGATGGAGATTTGAAGATTTA
GATAAACATGGTAAGCGTGTGGCAGTGTGTAGTAATTGTCACGTTGAATA
TTATTTCAAAGATAAAAAAGATGTTACTTTCCCATGGGCGAAAGGTGTTG
ATGTAGATAGTATTGAAAAATATTACGATGAATCTCAATTTACGGATTGG
ACTCACGCATTATCTAAAGCGCCTATGTTAAAAACTCAGCATCCAGATTT
TGAGGTTTGGTCACAAGGAGTACACGGTAAAAATGGTGTTACGTGTATTG
ATTGCCATATGCCAAAAGTTAAAGATAAAGACGGTAAAGTTTATACGGAA
CACAAAATTGGCAATCCATTTGATCGCTTTGATGCAACGTGTAAAACATG
CCATGAACAGAGTAAGCAAACATTACAAGATCGTGTGAAAGAACATAAAG
CCCAAGTAAAAGAAGCAATGATTCGCTTAGAAGATCAAATTGTTAAAGCA
CATTTTGAGGCGAAAGTAGCTTGGGATGCGGGTGCAACAGCAGAAGAAAT
GCAAGACATTTTAATGGCAATTCGTCATGCTCAATGGCGTTGGGATTATT
CTGCTGCAGGACATGGTAACCATTTCCATGCGCCAGATGTTATGTTGCAC
ACTATCGCAACTGGGTTGGATCGTGTCGCTGATGCACGTGCGAAACTTGG
TGTGGTGTTAACCAAACACGGCGTTGAGACACCTATTGTGATGCCAGATA
TTTCAACAAGAGAAAAAGCACAAAAAGCGGTTGGTATTGATATTGCTAAA
GATCAAGCGGCTAAAGATGAGTTTTTACGTACCGTTGTGCCACAGTGGGA
AAGACAAGCGCGTGAAAGAGGCTTATTACCTGAAGTTACGCCAAAATCAG
TGACGACACCTAAAGTAGATGCTAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy