Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR246 IGR243 IGR242 IGR249 IGR247 IGR245 IGR244 IGR250 IGR248 HD0343 HD0338 HD0340 engB, - HD0342 rluC, - HD0337 HD0339 nrfB, - HD0347 nrfC,fdoH, - HD0349 kdsB,kpsU, - HD0334 trxA,ybbN, - HD0331 nrfD, - HD0350 trxB, - HD0333 nrfA, - HD0344 prfC, - HD0351 HD0343 HD0338 HD0340 engB, - HD0342 rluC, - HD0337 HD0339 nrfB, - HD0347 nrfC,fdoH, - HD0349 kdsB,kpsU, - HD0334 trxA,ybbN, - HD0331 nrfD, - HD0350 trxB, - HD0333 nrfA, - HD0344 prfC, - HD0351 HD0343 HD0338 HD0340 engB, - HD0342 rluC, - HD0337 HD0336 HD0336 HD0339 nrfB, - HD0347 nrfC,fdoH, - HD0349 kdsB,kpsU, - HD0334 nrfD, - HD0350 trxB, - HD0333 nrfA, - HD0344 prfC, - HD0351 HD0332 trxA,ybbN, - HD0331 HD0332
* Calculated from Protein Sequence

Gene ID: HD0343

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
267921

Gene Stop:
267499

Gene Length:
423

Molecular Weight*:
15963

pI*:
10.30

Net Charge*:
6.08

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 9-132 are 28% similar to >16762352 putative membrane protein [Salmonella enterica subsp. enterica serovar Typhi].

Residues 9 to 132 are 29% ( EScore : 2e-06 ) identical to sp|P32161|YIIR_ECOLI HYPOTHETICAL 16.5 KD PROTEIN IN TPIA-FPR INTERGENIC REGION between residues 7 and 131 in [Escherichia coli]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0343 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 8 to 136 (E-value = 2.5e-14) place HD0343 in the DUF805 family which is described as Protein of unknown function (DUF805) (PF05656)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MVMIWYKALFSFNGRLNRQGFWIGFGINFIFLFIIANFGPKETAFSLTMV
LPLLLASYSCVAVIIKRLHDRNRSARAILMMFIPLICYGVSLATQGTMAW
LLGVMMPMFIGTMLLLEWGVFKSYPQANQYGEKGETFCFT$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGTTATGATTTGGTATAAAGCGCTTTTCTCCTTTAATGGCAGACTCAA
TCGCCAAGGATTTTGGATTGGATTTGGCATTAACTTTATCTTCTTATTTA
TAATTGCTAATTTCGGGCCAAAAGAGACCGCTTTCAGCCTGACAATGGTA
TTACCTTTGCTATTAGCAAGTTACAGTTGCGTGGCAGTAATCATTAAACG
GTTACATGATCGCAATCGTTCCGCTCGTGCTATTTTGATGATGTTTATAC
CGCTAATCTGCTATGGTGTTTCACTTGCTACACAAGGCACAATGGCTTGG
TTACTCGGTGTGATGATGCCAATGTTTATTGGCACAATGCTATTACTAGA
ATGGGGCGTTTTCAAAAGCTATCCTCAAGCTAACCAATATGGCGAAAAAG
GGGAAACTTTTTGTTTCACGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy