Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR246 IGR243 IGR241 IGR242 IGR249 IGR239 IGR247 IGR245 IGR244 IGR240 IGR248 exbB, - HD0329 exbD, - HD0328 HD0338 HD0343 HD0340 engB, - HD0342 rluC, - HD0337 HD0339 glpE, - HD0330 nrfB, - HD0347 nrfC,fdoH, - HD0349 kdsB,kpsU, - HD0334 trxA,ybbN, - HD0331 trxB, - HD0333 nrfA, - HD0344 exbB, - HD0329 exbD, - HD0328 HD0338 HD0343 HD0340 engB, - HD0342 rluC, - HD0337 HD0339 glpE, - HD0330 nrfB, - HD0347 nrfC,fdoH, - HD0349 kdsB,kpsU, - HD0334 trxA,ybbN, - HD0331 trxB, - HD0333 nrfA, - HD0344 exbD, - HD0328 HD0338 HD0343 HD0340 engB, - HD0342 rluC, - HD0337 HD0336 HD0336 exbB, - HD0329 HD0339 glpE, - HD0330 nrfC,fdoH, - HD0349 kdsB,kpsU, - HD0334 trxA,ybbN, - HD0331 trxB, - HD0333 nrfA, - HD0344 HD0332 HD0332 nrfB, - HD0347
* Calculated from Protein Sequence

Gene ID: HD0338

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
265836

Gene Stop:
265414

Gene Length:
423

Molecular Weight*:
16513

pI*:
8.70

Net Charge*:
3.09

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 41 to 109 are 36% ( EScore : 2e-07 ) identical to pir||C70004 conserved hypothetical protein ytzA - Bacillus subtilis >2635382|emb|CAB14877.1| between residues 55 and 123 in [Bacillus subtilis]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 42-89 are 52% similar to a (COMPLETE PROTEOME FXSA OF) protein domain (PD020977) which is seen in Q9CLU8_PASMU.



Paralogs:  Local Blast Search
HD0338 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 7 to 112 (E-value = 1.1e-21) place HD0338 in the FxsA family which is described as FxsA cytoplasmic membrane protein (PF04186)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPFLFIFFTIIFYIYCEISLLISLSLIGLWLVRLRGLHLLYSIQQQLSRG
ELPAEAVFRSLFFMLAGILLIIPGFLSDILAIFCLLPITRHLIKGWLISW
FKHKIQRKQANEANYHHTTQDDTTFDAQFERQQDPDKWIK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCATTTTTATTCATTTTCTTCACCATTATCTTTTACATTTACTGTGA
AATTTCGCTACTCATCAGTCTTTCATTAATTGGCCTTTGGTTGGTAAGGT
TAAGAGGGCTACATCTTCTCTATAGCATTCAACAACAATTGAGCCGTGGC
GAACTCCCCGCTGAAGCTGTTTTTCGTTCGCTATTTTTTATGTTAGCCGG
TATTTTGTTAATCATTCCCGGTTTTTTAAGCGATATTTTAGCTATCTTTT
GCCTATTGCCCATCACTCGCCACCTCATCAAAGGCTGGTTAATTAGTTGG
TTTAAGCATAAAATACAGCGCAAACAGGCTAATGAAGCTAACTATCATCA
CACAACGCAAGATGATACAACCTTTGACGCTCAATTTGAACGTCAGCAAG
ATCCAGATAAATGGATAAAATAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy