Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR246 IGR243 IGR238 IGR241 IGR242 IGR239 IGR247 IGR245 IGR237 IGR244 IGR240 IGR248 HD0326 exbB, - HD0329 exbD, - HD0328 HD0343 HD0338 HD0340 engB, - HD0342 rluC, - HD0337 tonB, - HD0327 HD0339 glpE, - HD0330 kdsB,kpsU, - HD0334 trxA,ybbN, - HD0331 trxB, - HD0333 nrfA, - HD0344 HD0326 exbB, - HD0329 exbD, - HD0328 HD0343 HD0338 HD0340 engB, - HD0342 rluC, - HD0337 tonB, - HD0327 HD0339 glpE, - HD0330 kdsB,kpsU, - HD0334 trxA,ybbN, - HD0331 trxB, - HD0333 nrfA, - HD0344 HD0326 exbB, - HD0329 exbD, - HD0328 HD0343 HD0338 HD0340 engB, - HD0342 rluC, - HD0337 tonB, - HD0327 HD0336 HD0336 HD0339 glpE, - HD0330 kdsB,kpsU, - HD0334 trxA,ybbN, - HD0331 trxB, - HD0333 nrfA, - HD0344 HD0332 HD0332
* Calculated from Protein Sequence

Gene ID: HD0334

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
kdsB  kpsU  

Definition:
3-deoxy-manno-octulosonate cytidylyltransferase

Gene Start:
263880

Gene Stop:
264641

Gene Length:
762

Molecular Weight*:
28172

pI*:
6.70

Net Charge*:
-0.94

EC:
2.7.7.38  

Functional Class:
Cell envelope; Surface polysaccharides, lipopolysaccharides and antigens  

Pathway: pathway table
Lipopolysaccharide biosynthesis

Secondary Evidence:
Pazzani,C., Rosenow,C., Boulnois,G.J., Bronner,D., Jann,K. and
Roberts,I.S.
Molecular analysis of region 1 of the Escherichia coli K5 antigen
gene cluster: a region encoding proteins involved in cell surface
expression of capsular polysaccharide
J. Bacteriol. 175 (18), 5978-5983 (1993)
MEDLINE: 93388530

Jelakovic,S., Jann,K. and Schulz,G.E.
The three-dimensional structure of capsule-specific CMP:
2-keto-3-deoxy-manno-octonic acid synthetase from Escherichia coli
FEBS Lett. 391 (1-2), 157-161 (1996)
MEDLINE: 96326629


Comment:
0

Blast Summary:  PSI-Blast Search
Residues 1 to 250 are 67% ( EScore : 2e-91 ) identical to sp|P44490|KDSB_HAEIN 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE between residues 1 and 252 in [Haemophilus influenzae Rd]
Residues 1 to 246 are 60% ( EScore : 8e-82 ) identical to sp|P04951|KDSB_ECOLI 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE between residues 1 and 244 in [Escherichia coli]
Residues 2 to 253 are 51% ( EScore : 3e-65 ) identical to emb|CAB84155.1| (AL162754) putative 3-deoxy-manno-octulosonate cytidylyltransferase between residues 3 and 253 in [Neisseria meningitidis]
Residues 2 to 253 are 51% ( EScore : 1e-64 ) identical to gb|AAF41093.1| (AE002422) 3-deoxy-D-manno-octulosonate cytidylyltransferase between residues 3 and 253 in [Neisseria meningitidis MC58]
Residues 3 to 249 are 46% ( EScore : 2e-51 ) identical to gb|AAF85098.1|AE004041_10 3-deoxy-manno-octulosonate cytidylyltransferase between residues 8 and 254 in [Xylella fastidiosa]
Residues 2 to 251 are 42% ( EScore : 1e-44 ) identical to sp|P42216|KSU5_ECOLI 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE between residues 3 and 240 in [Escherichia coli]
Residues 6 to 251 are 38% ( EScore : 2e-39 ) identical to gb|AAF30349.1|AC019018_27 putative deoxyoctulonosic acid synthetase between residues 48 and 286 in [Arabidopsis thaliana]
Residues 6 to 249 are 37% ( EScore : 2e-36 ) identical to emb|CAB89846.1| (AJ242474) CMP-KDO synthetase between residues 56 and 292 in [Zea mays]
Residues 6 to 249 are 36% ( EScore : 5e-36 ) identical to sp|Q59320|KDSB_CHLTR 3-DEOXY-MANNO-OCTULOSONATE CYTIDYLYLTRANSFERASE between residues 12 and 246 in [Chlamydia trachomatis]
Residues 7 to 249 are 36% ( EScore : 5e-36 ) identical to emb|CAB89847.1| (AJ250331) CMP-KDO synthetase between residues 1 and 236 in [Zea mays]

COGS Summary:  COGS Search
BeTs to 5 clades of COG1212
COG name: CMP-2-keto-3-deoxyoctulosonic acid synthetase
Functional Class:  M
The phylogenetic pattern of COG1212 is -----q--e--huj----inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB003329 (Cytidylyltransferase (CMP-NeuAc synthetase)) with a combined E-value of 2.3e-24.
    IPB003329A    6-23
    IPB003329B    45-62
    IPB003329C    209-223


ProDom Summary:  Protein Domain Search
Residues 3-118 are 74% similar to a (TRANSFERASE COMPLETE PROTEOME BIOSYNTHESIS) protein domain (PD000318) which is seen in KDSB_PASMU.

Residues 123-249 are 61% similar to a (SYNTHETASE CYTIDYLYLTRANSFERASE) protein domain (PD011218) which is seen in KDSB_PASMU.

Residues 5-109 are 75% similar to a (SYNTHETASE CYTIDYLYLTRANSFERASE) protein domain (PD007621) which is seen in KDSB_HAEIN.



Paralogs:  Local Blast Search


HD0334 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 223 (E-value = 5.4e-81) place HD0334 in the CTP_transf_3 family which is described as Cytidylyltransferase (PF02348)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKFTVIIPARYASSRLPGKPLLDINGYPMIQYVWQKAQQAGANRVIIATD
HPQIQTVAKAFGAEVCMTSDQHQSGTERLAEVVAKMAIADQEIIVNVQGD
EPLIPPIIVQQVATNLDKNGVNMATLAVKLTTREELFNPNVVKTVINDKG
MALYFSRAAVPFARDHFSECDDTFVASQCYLRHIGIYAYRAGFIKQYVAW
QPTVLEQLESLEQLRALWYGEQIHVELAKQAPALGVDTAQDLARVRQMLS
QTV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAATTTACAGTAATTATTCCTGCCCGCTATGCTTCAAGCCGTTTGCC
GGGTAAGCCATTATTAGATATTAATGGCTATCCTATGATTCAATATGTTT
GGCAGAAAGCACAACAAGCGGGAGCAAATCGTGTCATTATTGCCACTGAT
CATCCACAAATTCAAACGGTGGCTAAAGCTTTTGGGGCAGAAGTTTGTAT
GACTTCTGATCAACATCAATCTGGCACTGAACGTTTGGCGGAAGTGGTAG
CGAAAATGGCGATTGCAGATCAGGAAATTATTGTTAATGTACAAGGCGAT
GAACCGTTAATTCCACCGATTATTGTGCAACAAGTCGCAACTAATTTGGA
TAAAAACGGTGTAAATATGGCAACGCTAGCGGTCAAATTAACTACTCGTG
AAGAGCTATTTAATCCGAATGTTGTGAAAACGGTGATTAATGACAAAGGA
ATGGCGCTTTATTTTTCTCGAGCCGCAGTGCCATTTGCACGAGATCATTT
TTCTGAATGTGATGATACTTTTGTCGCAAGCCAATGTTATTTGCGCCATA
TTGGGATTTATGCTTATCGAGCTGGCTTTATTAAACAGTATGTTGCTTGG
CAGCCGACGGTGTTAGAACAATTAGAGTCGTTAGAGCAACTGCGTGCTTT
ATGGTATGGCGAGCAAATTCACGTTGAGCTAGCTAAGCAAGCTCCTGCCT
TGGGCGTGGATACTGCACAAGATTTAGCGCGAGTACGGCAAATGTTAAGC
CAAACCGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy