Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Val-3 tRNA-Val-2 tRNA-Ala-3 tRNA-Val-1 IGR234 IGR238 IGR241 IGR233 IGR229 IGR239 IGR236 IGR228 IGR235 IGR232 IGR237 IGR231 IGR240 IGR230 ydhD, - HD0324 HD0326 HD0322 exbB, - HD0329 exbD, - HD0328 HD0318 recR, - HD0325 sodA, - HD0321 tonB, - HD0327 yfgB, - HD0319 tex, - HD0317 HD0323 glpE, - HD0330 trxA,ybbN, - HD0331 gltX, - HD0320 ydhD, - HD0324 HD0326 HD0322 exbB, - HD0329 exbD, - HD0328 HD0318 recR, - HD0325 sodA, - HD0321 tonB, - HD0327 yfgB, - HD0319 tex, - HD0317 HD0323 glpE, - HD0330 trxA,ybbN, - HD0331 gltX, - HD0320 HD0326 HD0322 exbB, - HD0329 exbD, - HD0328 HD0318 recR, - HD0325 sodA, - HD0321 tonB, - HD0327 yfgB, - HD0319 tex, - HD0317 ydhD, - HD0324 HD0323 trxA,ybbN, - HD0331 gltX, - HD0320 glpE, - HD0330
* Calculated from Protein Sequence

Gene ID: HD0321

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
sodA  

Definition:
manganese superoxide dismutase

Gene Start:
257503

Gene Stop:
256862

Gene Length:
642

Molecular Weight*:
24092

pI*:
6.40

Net Charge*:
-2.97

EC:
1.15.1.1  

Functional Class:
Cellular processes; Detoxification  

Pathway: pathway table

Primary Evidence:
San Mateo,L.R., Toffer,K.L. and Kawula,T.H.
The sodA gene of Haemophilus ducreyi encodes a hydrogen
peroxide-inhibitable superoxide dismutase
Gene 207 (2), 251-257 (1998)
MEDLINE: 98172759


Secondary Evidence:
Nakayama,K.
Nucleotide sequence of Streptococcus mutans superoxide dismutase
gene and isolation of insertion mutants
J. Bacteriol. 174 (15), 4928-4934 (1992)
Medline: 92332426

Martin,M.E., Byers,B.R., Olson,M.O., Salin,M.L., Arceneaux,J.E. and Tolbert,C.
A Streptococcus mutans superoxide dismutase that is active with
either manganese or iron as a cofactor
J. Biol. Chem. 261 (20), 9361-9367 (1986)
Medline: 86250886

Poyart,C., Quesne,G., Coulon,S., Berche,P. and Trieu-Cuot,P.
Identification of streptococci to species level by sequencing the
gene encoding the manganese-dependent superoxide dismutase
J. Clin. Microbiol. 36 (1), 41-47 (1998)
Medline: 98092214

Gerlach,D., Reichardt,W. and Vettermann,S.
Extracellular superoxide dismutase from Streptococcus pyogenes type 12 strain is
manganese-dependent
FEMS Microbiol. Lett. 160 (2), 217-224 (1998)
Medline: 98193933

Gibson,C.M. and Caparon,M.G.
Insertional inactivation of Streptococcus pyogenes sod suggests
that prtF is regulated in response to a superoxide signal
J. Bacteriol. 178 (15), 4688-4695 (1996)
Medline: 96345638

Poyart,C., Berche,P. and Trieu-Cuot,P.
Characterization of superoxide dismutase genes from gram-positive
bacteria by polymerase chain reaction using degenerate primers
FEMS Microbiol. Lett. 131 (1), 41-45 (1995)
Medline: 96045282

Inaoka,T., Matsumura,Y. and Tsuchido,T.
Molecular cloning and nucleotide sequence of the superoxide
dismutase gene and characterization of its product from Bacillus
subtilis
J. Bacteriol. 180 (14), 3697-3703 (1998)
Medline: 98324982

Sanders,J.W., Leenhouts,K.J., Haandrikman,A.J., Venema,G. and
Kok,J.
Stress response in Lactococcus lactis: cloning, expression
analysis, and mutation of the lactococcal superoxide dismutase gene
J. Bacteriol. 177 (18), 5254-5260 (1995)
Medline: 95394843

Bowler,C., Van Kaer,L., Van Camp,W., Van Montagu,M., Inze,D. and
Dhaese,P.
Characterization of the Bacillus stearothermophilus manganese
superoxide dismutase gene and its ability to complement copper/zinc superoxide dismutase
deficiency in Saccharomyces cerevisiae
J. Bacteriol. 172 (3), 1539-1546 (1990)
Medline: 90170872

Comment:
0

Blast Summary:  PSI-Blast Search
This sequence corresponds to the previously reported gi 2407235, 6094321, 7433322.

Residues 1 to 213 are 94% ( EScore : 1e-119 ) identical to sp|O30826|SODM_HAEDU SUPEROXIDE DISMUTASE [MN] >7433322|pir||JC6542 superoxide dismutase between residues 1 and 213 in [Haemophilus ducreyi]
Residues 1 to 213 are 82% ( EScore : 1e-106 ) identical to gb|AAB03279.1| (U51441) manganese superoxide dismutase between residues 1 and 213 in [Actinobacillus pleuropneumoniae]
Residues 1 to 213 are 81% ( EScore : 1e-104 ) identical to sp|Q59679|SODM_PASHA SUPEROXIDE DISMUTASE [MN] >1161158|gb|AAA85362.1| between residues 1 and 213 in [Pasteurella haemolytica serotype 1]
Residues 1 to 213 are 69% ( EScore : 2e-85 ) identical to sp|P43725|SODM_HAEIN SUPEROXIDE DISMUTASE [MN] >1075332|pir||C64182 superoxide dismutase between residues 1 and 215 in [Haemophilus influenzae Rd]
Residues 1 to 207 are 70% ( EScore : 7e-84 ) identical to pir||S39871 superoxide dismutase between residues 1 and 209 in [Haemophilus influenzae]
Residues 1 to 204 are 69% ( EScore : 9e-82 ) identical to sp|P53655|SODM_YEREN SUPEROXIDE DISMUTASE [MN] >1237254|emb|CAA65596.1| between residues 1 and 205 in [Yersinia enterocolitica]
Residues 1 to 205 are 68% ( EScore : 3e-80 ) identical to sp|P43019|SODM_SALTY SUPEROXIDE DISMUTASE [MN] >808038|gb|AAC43331.1| between residues 1 and 205 in [Salmonella typhimurium]
Residues 1 to 206 are 66% ( EScore : 5e-79 ) identical to sp|P00448|SODM_ECOLI SUPEROXIDE DISMUTASE [MN] >1070455|pir||DSECN superoxide dismutase between residues 1 and 206 in [Escherichia coli]
Residues 2 to 206 are 66% ( EScore : 2e-78 ) identical to pdb|1D5N|A between residues 1 and 205
Residues 1 to 202 are 57% ( EScore : 6e-65 ) identical to pir||B75415 superoxide dismutase between residues 1 and 207 in [Deinococcus radiodurans]

COGS Summary:  COGS Search
BeTs to 11 clades of COG0605
COG name: Superoxide dismutase
Functional Class:  P
The phylogenetic pattern of COG0605 is --t-Yq-cEBrhuj--o-inx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001189 (Manganese and iron superoxide dismutase (SODM)) with a combined E-value of 9.2e-94.
    IPB001189A    5-40
    IPB001189B    75-91
    IPB001189C    95-132
    IPB001189D    163-195


ProDom Summary:  Protein Domain Search
Residues 2-207 are 94% similar to a (DISMUTASE SUPEROXIDE OXIDOREDUCTASE MANGANESE MN IRON) protein domain (PD000475) which is seen in SODM_HAEDU.



Paralogs:  Local Blast Search
HD0321 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 2 to 90 (E-value = 1.3e-43) place HD0321 in the Sod_Fe_N family which is described as Iron/manganese superoxide dismutases, alpha-hairpin domain (PF00081)
Residues 92 to 202 (E-value = 1.6e-65) place HD0321 in the Sod_Fe_C family which is described as Iron/manganese superoxide dismutases, C-terminal domain (PF02777)

PDB Hit:
pdb|1D5N|A Chain A, Crystal Structure Of E. Coli Mnsod At 100k ... 292 2e-080
pdb|1MNG|A Chain A, Manganese Superoxide Dismutase (E.C.1.15.1.... 208 5e-055
pdb|1VAR|A Chain A, Mitochondrial Manganese Superoxide Dismutas... 164 9e-042

Gene Protein Sequence:
MTYQLPELGYAYDALEPYFDKETMEIHHSKHHQAYVNNSNALLEKHPELL
EKCPGALLKDLTQVPAEKRTAVRNNLGGHVNHTLFWKGLKTGTTLQGALK
DAIIRDFGSVEAFQAEFEQAAATRFGSGWAWLVLEEGKLAVVSTANQDSP
IMGKDVAGVSGYPIFTLDVWEHAYYLHYQNRRPDYIKAFWNVVNWDEASR
RFEEKQAGCGCTK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACATATCAATTACCTGAATTAGGCTATGCTTATGATGCATTAGAGCC
ATATTTCGATAAAGAAACGATGGAAATCCATCATTCAAAACATCACCAAG
CTTATGTAAATAATTCAAATGCATTATTAGAAAAGCATCCTGAACTACTA
GAAAAATGTCCCGGTGCATTATTAAAAGATTTAACTCAAGTGCCTGCTGA
AAAACGTACAGCTGTACGTAATAACTTAGGTGGTCACGTAAACCACACAT
TATTTTGGAAAGGCTTAAAAACAGGTACCACGTTACAAGGTGCATTAAAA
GATGCAATTATCCGCGATTTTGGTTCCGTAGAAGCATTCCAAGCCGAGTT
TGAACAAGCCGCAGCGACTCGTTTTGGTTCTGGATGGGCTTGGCTGGTCT
TAGAAGAAGGCAAACTAGCGGTTGTTTCAACTGCTAACCAAGATTCGCCT
ATTATGGGCAAAGATGTAGCCGGCGTTTCAGGCTACCCTATTTTTACTTT
AGATGTTTGGGAACACGCTTACTATTTACATTATCAAAATCGCCGTCCAG
ACTACATTAAGGCTTTCTGGAATGTGGTGAATTGGGATGAAGCATCACGC
CGTTTTGAAGAAAAACAAGCTGGTTGCGGATGCACCAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy