Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Val-3 tRNA-Val-2 tRNA-Ala-3 tRNA-Val-1 IGR234 IGR238 IGR233 IGR229 IGR236 IGR228 IGR235 IGR232 IGR237 IGR231 IGR230 ydhD, - HD0324 HD0326 HD0322 exbD, - HD0328 HD0318 recR, - HD0325 sodA, - HD0321 tonB, - HD0327 yfgB, - HD0319 tex, - HD0317 HD0323 gltX, - HD0320 ydhD, - HD0324 HD0326 HD0322 exbD, - HD0328 HD0318 recR, - HD0325 sodA, - HD0321 tonB, - HD0327 yfgB, - HD0319 tex, - HD0317 HD0323 gltX, - HD0320 HD0326 HD0322 exbD, - HD0328 HD0318 recR, - HD0325 sodA, - HD0321 tonB, - HD0327 yfgB, - HD0319 tex, - HD0317 ydhD, - HD0324 HD0323 gltX, - HD0320
* Calculated from Protein Sequence

Gene ID: HD0320

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
gltX  

Definition:
glutamyl-tRNA synthetase

Gene Start:
255169

Gene Stop:
256608

Gene Length:
1440

Molecular Weight*:
54905

pI*:
6.20

Net Charge*:
-7.29

EC:
6.1.1.17  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Glutamate metabolism
Porphyrin and chlorophyll metabolism

Secondary Evidence:
Breton,R., Sanfacon,H., Papayannopoulos,I., Biemann,K. and
Lapointe,J.
Glutamyl-tRNA synthetase of Escherichia coli. Isolation and primary structure of the gltX gene and homology with other aminoacyl-tRNA synthetases
J. Biol. Chem. 261 (23), 10610-10617 (1986)
Medline: 86278132

Brun,Y.V., Sanfacon,H., Breton,R. and Lapointe,J.
Closely spaced and divergent promoters for an aminoacyl-tRNA
synthetase gene and a tRNA operon in Escherichia coli.
Transcriptional and post-transcriptional regulation of gltX, valU
and alaW
J. Mol. Biol. 214 (4), 845-864 (1990)
Medline: 90355200


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to glutamyl-tRNA synthetases. Residues 1-479 are 79% similar to this enzyme from Haemophilus influenzae (16272232|) and are 78% similar to this enzyme from Pasteurella multocida (15602980|).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0008
COG name: Glutamyl- and glutaminyl-tRNA synthetases
Functional Class: J
The phylogenetic pattern of COG0008 is amtkYqVcEbrHUJgpolinX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 254-303 are 86% similar to a (SYNTHETASE LIGASE GLUTAMYL-TRNA AMINOACYL-TRNA GLURS) protein domain (PD265942) which is seen in SYE_VIBCH.

Residues 304-353 are 78% similar to a (SYNTHETASE LIGASE GLUTAMYL-TRNA) protein domain (PD403930) which is seen in SYE_HAEIN.

Residues 18-253 are 90% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA GLUTAMYL-TRNA) protein domain (PD001595) which is seen in SYE_HAEIN.

Residues 354-478 are 58% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA ATP-BINDING) protein domain (PD002794) which is seen in SYE_PASMU.

Residues 304-351 are 60% similar to a (LIGASE SYNTHETASE ATP-BINDING) protein domain (PD258371) which is seen in SYE_ECOLI.



Paralogs:  Local Blast Search

HD0320 is paralogously related to HD1404 (4e-17).


Pfam Summary:  Pfam Search
Residues 14 to 316 (E-value = 2.9e-182) place HD0320 in the tRNA-synt_1c family which is described as tRNA synthetases class I (E and Q), catalytic domain (PF00749)

PDB Hit:
pdb|1GLN| Mol_id: 1; Molecule: Glutamyl-Trna Synthetase; Chai... 285 9e-078
pdb|1QRS|A Chain A, Glutaminyl-Trna Synthetase Mutant D235n Com... 72 1e-013
pdb|1EUQ|A Chain A, Crystal Structure Of Glutaminyl-Trna Synthe... 71 2e-013

Gene Protein Sequence:
MNIETLFPLDPNVKVRTRFAPSPTGYLHVGGARTALYSWLYAKHFNGEFV
LRIEDTDLERSTPEATAAILEGMEWLNLTWEHGPYFQTKRFDRYNQVIDQ
MIEQGLAYRCYCSKDRLEQLRNEQEASKEKPRYDRHCLNHQDRSINEPHV
VRFKNPQQGSVVFDDAVRGRIEISNSELDDLIIRRTDGSPTYNFCVVVDD
WDMGITHVVRGEDHINNTPRQINILKALGAPIPTYAHVSMINGDDGQKLS
KRHGAVSVMQYRDDGYLPEALINYLVRLGWGHGDQEIFSREEMIELFDLH
SVSRSASAFNTEKLQWLNQHYMRTLPAEYVAKYLEWHMHDQAIDIANGPT
LTELIPVLSERAKTLKELATASRYFYQEFDAYDEKAVAKTFKLEAEQPLT
MLWEKLTALVDWNVENIHQAMNATATELGIGMGKVGMPFRLAVTGSAQSP
SMDITAKLVGRERTLARLQKAIKFIQAQS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATATTGAAACTCTTTTTCCTTTAGATCCTAATGTGAAAGTACGCAC
GCGTTTTGCGCCAAGTCCAACAGGTTATTTACACGTAGGGGGCGCGCGTA
CAGCGCTTTATTCTTGGTTATATGCGAAACATTTTAATGGTGAATTTGTA
TTACGTATTGAAGATACTGACCTTGAACGTTCTACGCCAGAAGCGACCGC
GGCGATTTTAGAGGGAATGGAATGGTTAAACCTTACTTGGGAACATGGGC
CATATTTTCAAACAAAGAGGTTTGATCGTTATAATCAAGTGATTGATCAA
ATGATTGAACAAGGTTTAGCATATCGTTGTTATTGTTCTAAAGATCGCTT
AGAGCAATTAAGAAATGAGCAGGAAGCAAGTAAAGAAAAACCGCGTTATG
ATCGTCATTGCTTAAACCATCAAGATCGTTCAATTAATGAACCGCATGTA
GTGCGTTTTAAGAACCCACAACAAGGCTCTGTTGTGTTTGATGATGCGGT
ACGCGGTCGTATTGAAATCAGTAATAGCGAATTAGATGATTTAATTATTC
GGCGTACAGACGGTTCTCCCACCTACAATTTCTGTGTGGTCGTAGATGAT
TGGGATATGGGGATTACACATGTTGTTCGTGGTGAAGATCATATTAATAA
TACACCGCGTCAAATCAATATTTTAAAGGCATTAGGTGCACCCATTCCAA
CTTATGCACACGTTTCAATGATTAATGGTGACGATGGGCAAAAACTTTCA
AAGCGTCATGGTGCGGTGAGCGTGATGCAATACCGCGATGATGGCTATTT
ACCTGAAGCATTGATTAACTATTTAGTTCGTTTAGGTTGGGGACATGGTG
ATCAAGAGATTTTTAGCCGTGAAGAGATGATTGAATTATTTGATCTTCAT
TCGGTAAGCCGTTCGGCAAGTGCATTTAATACAGAAAAATTGCAATGGCT
CAATCAACATTATATGCGTACTTTGCCAGCTGAGTATGTCGCTAAATATC
TTGAATGGCATATGCACGATCAAGCTATTGATATTGCGAATGGACCTACT
TTAACTGAGCTTATTCCTGTGTTAAGTGAGCGAGCTAAAACCTTAAAAGA
GTTAGCAACAGCAAGTCGCTATTTTTATCAAGAGTTTGATGCGTATGATG
AAAAAGCAGTAGCGAAAACGTTTAAACTGGAAGCAGAACAGCCATTGACA
ATGTTATGGGAAAAATTAACCGCTTTAGTTGATTGGAATGTAGAAAATAT
TCATCAAGCAATGAATGCTACGGCAACGGAATTAGGCATAGGTATGGGCA
AAGTTGGCATGCCATTCCGTTTAGCGGTAACAGGTTCTGCTCAATCACCG
TCAATGGATATTACTGCTAAATTAGTTGGGCGTGAACGTACTTTAGCACG
TTTACAAAAAGCGATTAAATTTATTCAAGCACAATCTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy