Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-2 tRNA-Ile-2 rRNA-16S-2 rRNA-23S-2 IGR221 IGR218 IGR219 IGR220 IGR222 IGR223 HD0306 yfhL, - HD0304 narP, - HD0305 talB, - HD0310 trmH,spoU, - HD0308 HD0303 ycbY, - HD0307 HD0306 yfhL, - HD0304 narP, - HD0305 talB, - HD0310 trmH,spoU, - HD0308 HD0303 ycbY, - HD0307 yfhL, - HD0304 narP, - HD0305 talB, - HD0310 HD0306 trmH,spoU, - HD0308 HD0303 ycbY, - HD0307
* Calculated from Protein Sequence

Gene ID: HD0310

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
talB  

Definition:
transaldolase B, talB

Gene Start:
239647

Gene Stop:
238700

Gene Length:
948

Molecular Weight*:
34914

pI*:
4.90

Net Charge*:
-6.88

EC:
2.2.1.2  

Functional Class:
Energy metabolism; Pentose phosphate pathway  

Pathway: pathway table
Pentose phosphate cycle

Comment:


Blast Summary:  PSI-Blast Search
Residues 3 to 315 are 79% ( EScore : 1e-140 ) identical to sp|P45055|TAL_HAEIN TRANSALDOLASE >1074653|pir||D64167 transaldolase between residues 4 and 317 in [Haemophilus influenzae Rd]
Residues 2 to 311 are 71% ( EScore : 1e-125 ) identical to pdb|1ONR|A between residues 2 and 312
Residues 2 to 311 are 71% ( EScore : 1e-125 ) identical to sp|P30148|TALB_ECOLI TRANSALDOLASE B >482023|pir||S40535 transaldolase between residues 3 and 313 in [Escherichia coli]
Residues 2 to 311 are 70% ( EScore : 1e-124 ) identical to pdb|1UCW|A between residues 3 and 313
Residues 1 to 315 are 64% ( EScore : 1e-111 ) identical to sp|P78258|TALA_ECOLI TRANSALDOLASE A >7433626|pir||G65021 transaldolase between residues 1 and 316 in [Escherichia coli]
Residues 2 to 315 are 63% ( EScore : 1e-109 ) identical to dbj|BAA83095.1| (AB026428) transaldolase between residues 3 and 316 in [Methylomonas aminofaciens]
Residues 1 to 315 are 57% ( EScore : 1e-97 ) identical to gb|AAF47106.1| (AE003462) CG2827 gene product between residues 1 and 319 in [Drosophila melanogaster]
Residues 4 to 315 are 56% ( EScore : 9e-92 ) identical to ref|NP_006746.1|| transaldolase 1 >6648092|sp|P37837|TAL1_HUMAN TRANSALDOLASE >2073541|gb|AAB53943.1| between residues 15 and 330 in [Homo sapiens]
Residues 4 to 315 are 56% ( EScore : 3e-91 ) identical to sp|Q93092|TAL1_MOUSE TRANSALDOLASE >2589166|gb|AAB83955.1| between residues 15 and 330 in [Mus musculus]
Residues 4 to 315 are 55% ( EScore : 3e-90 ) identical to pir||A49985 between residues 15 and 329

COGS Summary:  COGS Search
BeTs to 10 clades of COG0176
COG name: Transaldolase
Functional Class: G
The phylogenetic pattern of COG0176 is -m--YqvcEbrhuj----in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001585 (Transaldolase) with a combined E-value of 8.4e-106.
    IPB001585A    23-38
    IPB001585B    89-111
    IPB001585C    128-141
    IPB001585D    148-183
    IPB001585E    198-226
    IPB001585F    284-307


ProDom Summary:  Protein Domain Search
Residues 32-89 are 86% similar to a (TRANSALDOLASE TRANSFERASE PENTOSE SHUNT) protein domain (PD349097) which is seen in Q9CKH9_PASMU.

Residues 31-142 are 65% similar to a (TRANSALDOLASE TRANSFERASE PENTOSE SHUNT) protein domain (PD003490) which is seen in TALA_ECOLI.

Residues 143-314 are 76% similar to a (TRANSALDOLASE TRANSFERASE SHUNT PENTOSE) protein domain (PD003884) which is seen in TAL_HAEIN.

Residues 90-142 are 77% similar to a (TRANSALDOLASE TRANSFERASE PENTOSE SHUNT) protein domain (PD416068) which is seen in TALB_ECOLI.



Paralogs:  Local Blast Search

HD0310 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 12 to 311 (E-value = 5e-165) place HD0310 in the Transaldolase family which is described as Transaldolase (PF00923)

PDB Hit:
pdb|1ONR|A Chain A, Structure Of Transaldolase B >gi|1941983|pd... 447 7e-127
pdb|1UCW|A Chain A, Complex Of Transaldolase With The Reduced S... 445 4e-126
pdb|1F05|A Chain A, Crystal Structure Of Human Transaldolase >g... 337 1e-093

Gene Protein Sequence:
MNQLDALREMTVVVADTGDIEAIRQYQPQDATTNPSLILSASALSQYAPL
IDDAIRYAKSKSGNKAQQLVDAEDKLAVNIGLEILKIVPGRISTEVDARF
SYDTEKTIAKARKLIGLYNEAGVANNRILIKIAATWQGIRAAEILEKEGI
NCNLTLLFSQAQARACAEAGVYLISPFVGRILDWYKANEKKEYAAAEDPG
VISVTAIYNYYKQYNYKTIVMGASFRNVGEITEIAGCDRLTIAPPLLKAL
AESNETLVRKLDYQGEILDRPAPLSEAEFYWQHNQDPMAVDKLAEGIRKF
AIDQEKLEEMLSAKL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAATCAATTAGATGCTTTACGCGAAATGACTGTGGTTGTTGCTGATAC
CGGTGATATAGAAGCCATTAGACAATATCAGCCTCAAGATGCTACCACTA
ATCCCTCGTTAATTTTAAGTGCTTCTGCATTATCACAATATGCGCCTTTA
ATTGATGATGCAATTCGTTATGCAAAATCAAAAAGTGGCAATAAGGCTCA
ACAGTTAGTTGATGCTGAAGATAAGCTTGCAGTTAATATTGGTTTGGAGA
TTTTGAAAATTGTTCCCGGACGAATTTCAACTGAGGTAGATGCTAGATTT
TCTTACGATACTGAAAAAACGATTGCTAAGGCACGTAAGCTGATTGGCTT
ATATAATGAAGCAGGTGTTGCTAATAATCGTATTTTGATCAAAATAGCGG
CTACTTGGCAAGGTATCCGTGCTGCTGAAATATTAGAAAAAGAGGGAATT
AATTGTAATTTAACATTATTATTCTCTCAAGCACAAGCCAGGGCCTGTGC
TGAAGCGGGCGTTTACTTGATTTCACCATTTGTTGGACGTATCTTAGACT
GGTATAAAGCAAATGAGAAAAAGGAATATGCCGCGGCAGAAGATCCGGGC
GTTATTTCGGTCACCGCTATTTATAACTACTATAAGCAGTACAATTATAA
GACTATTGTTATGGGGGCAAGCTTCCGAAATGTAGGTGAAATTACTGAAA
TTGCAGGCTGTGATCGTTTAACTATTGCGCCGCCATTATTAAAAGCATTA
GCGGAAAGCAATGAAACATTGGTGCGTAAGTTAGATTATCAAGGTGAGAT
TTTAGATCGCCCTGCGCCTTTAAGCGAAGCTGAGTTTTATTGGCAACATA
ACCAAGATCCTATGGCCGTGGACAAATTAGCCGAAGGTATCCGTAAATTT
GCGATTGACCAAGAAAAATTAGAAGAGATGCTTTCAGCAAAACTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy