Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap tRNA-Ala-2 tRNA-Ile-2 rRNA-16S-2 rRNA-23S-2 IGR217 IGR221 IGR218 IGR219 IGR220 IGR222 IGR223 HD0306 yfhL, - HD0304 narP, - HD0305 talB, - HD0310 trmH,spoU, - HD0308 HD0302 HD0303 ycbY, - HD0307 HD0306 yfhL, - HD0304 narP, - HD0305 talB, - HD0310 trmH,spoU, - HD0308 HD0302 HD0303 ycbY, - HD0307 yfhL, - HD0304 narP, - HD0305 talB, - HD0310 HD0306 trmH,spoU, - HD0308 HD0302 HD0303 ycbY, - HD0307
* Calculated from Protein Sequence

Gene ID: HD0308

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
trmH  spoU  

Definition:
tRNA/rRNA methyltransferase

Gene Start:
238122

Gene Stop:
238601

Gene Length:
480

Molecular Weight*:
18233

pI*:
8.40

Net Charge*:
2.81

EC:
2.1.1.34  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1 to 154 are 72% ( EScore : 5e-63 ) identical to sp|P44868|YIBK_HAEIN HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE HI0766 >1074511|pir||E64158 hypothetical protein HI0766 between residues 1 and 154 in [Haemophilus influenzae Rd]
Residues 1 to 156 are 66% ( EScore : 6e-59 ) identical to sp|P33899|YIBK_ECOLI HYPOTHETICAL TRNA/RRNA METHYLTRANSFERASE YIBK >1073422|pir||S47827 yibK protein >466744|gb|AAB18583.1| between residues 1 and 156 in [Escherichia coli]
Residues 1 to 154 are 57% ( EScore : 6e-49 ) identical to emb|CAB85429.1| (AL162758) putative tRNA/rRNA methyltransferase between residues 1 and 154 in [Neisseria meningitidis]
Residues 1 to 154 are 57% ( EScore : 2e-48 ) identical to gb|AAF40722.1| (AE002383) RNA methyltransferase, TrmH family between residues 1 and 154 in [Neisseria meningitidis MC58]
Residues 4 to 151 are 52% ( EScore : 8e-44 ) identical to gb|AAF84774.1|AE004016_8 tRNA/rRNA methylase between residues 1 and 148 in [Xylella fastidiosa]
Residues 1 to 154 are 42% ( EScore : 1e-32 ) identical to emb|CAB09926.1| (Z97179) rRNA methylase between residues 16 and 169 in [Mycobacterium leprae]
Residues 1 to 154 are 41% ( EScore : 8e-31 ) identical to pir||E70971 probable rRNA methylase - Mycobacterium tuberculosis between residues 1 and 154 in [Mycobacterium tuberculosis]
Residues 2 to 144 are 45% ( EScore : 1e-29 ) identical to pir||S71440 hypothetical protein 3 - Bacillus circulans between residues 3 and 144 in [Bacillus circulans subsp. alkalophilus]
Residues 2 to 151 are 41% ( EScore : 4e-29 ) identical to gb|AAB02738.1| (U58864) CspR between residues 3 and 154 in [Bacillus subtilis]
Residues 2 to 151 are 41% ( EScore : 6e-29 ) identical to pir||G69608 rRNA methylase homolog cspR - Bacillus subtilis >2633216|emb|CAB12721.1| between residues 6 and 157 in [Bacillus subtilis]

COGS Summary:  COGS Search
BeTs to 6 clades of COG0219
COG name: Predicted rRNA methylase (SpoU class)
Functional Class: J
The phylogenetic pattern of COG0219 is -------cebrh--gp--in-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001537 (tRNA/rRNA methyltransferase (SpoU)) with a combined E-value of 5.1e-20.
    IPB001537A    4-28
    IPB001537B    97-105
    IPB001537C    130-143


ProDom Summary:  Protein Domain Search
Residues 1-151 are 27% similar to a (METHYLASES SPOU METHYLTRANSFERASE OF) protein domain (PD091729) which is seen in O04633_ARATH.

Residues 43-147 are 34% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE RNA) protein domain (PD394935) which is seen in Q9RXS5_DEIRA.

Residues 44-150 are 70% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE METHYLASE RRNA) protein domain (PD331903) which is seen in Q9CKU3_PASMU.

Residues 4-43 are 87% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE METHYLASE RRNA) protein domain (PD339659) which is seen in Q9CKU3_PASMU.



Paralogs:  Local Blast Search
HD0308 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 142 (E-value = 1.2e-48) place HD0308 in the SpoU_methylase family which is described as SpoU rRNA Methylase family (PF00588)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLDIVLFEPEIPQNSGNIIRLCANCGFRLHMIEPFGFTWDDKKLKRSGLD
YHEFVDIQKYTHFDDFLARAKPKRLFALTTKGEANHSQVQYEQGNFLMFG
PESRGIPTAILETLPMSQKIRVPMCKDSRSMNLSNTVAVVVYEAWRQFGY
QGAVARQAI$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGATATTGTGTTATTTGAGCCTGAAATTCCACAAAATAGTGGGAA
TATTATTCGATTATGTGCAAATTGTGGTTTTCGATTGCATATGATTGAAC
CCTTTGGTTTTACTTGGGATGATAAAAAATTAAAACGTTCTGGTTTGGAT
TATCATGAATTTGTCGATATTCAAAAATATACTCATTTTGATGATTTTCT
TGCTCGTGCAAAGCCTAAACGTTTATTTGCATTAACGACTAAAGGTGAAG
CAAATCATAGCCAAGTACAATACGAACAAGGCAATTTTTTGATGTTTGGT
CCAGAAAGTCGTGGAATTCCAACCGCTATTTTAGAGACTTTGCCAATGTC
ACAAAAAATCCGAGTACCTATGTGTAAAGATAGTCGAAGTATGAACTTAT
CAAATACCGTGGCAGTAGTCGTGTATGAAGCTTGGCGACAATTTGGTTAT
CAAGGTGCTGTAGCAAGACAAGCCATTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy