Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR217 IGR215 IGR212 IGR210 IGR218 IGR219 IGR220 IGR214 IGR216 IGR211 IGR213 HD0306 yfhL, - HD0304 HD0297 narP, - HD0305 rph, - HD0301 grx, - HD0300 tpn, - HD0295 HD0296 HD0298 HD0302 HD0303 bipA,typA, - HD0299 ycbY, - HD0307 HD0306 yfhL, - HD0304 HD0297 narP, - HD0305 rph, - HD0301 grx, - HD0300 tpn, - HD0295 HD0296 HD0298 HD0302 HD0303 bipA,typA, - HD0299 ycbY, - HD0307 yfhL, - HD0304 HD0297 narP, - HD0305 rph, - HD0301 HD0306 grx, - HD0300 HD0296 HD0298 HD0302 HD0303 bipA,typA, - HD0299 ycbY, - HD0307 tpn, - HD0295
* Calculated from Protein Sequence

Gene ID: HD0301

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
rph  

Definition:
ribonuclease PH (RNase PH)

Gene Start:
232814

Gene Stop:
232098

Gene Length:
717

Molecular Weight*:
26175

pI*:
5.30

Net Charge*:
-5.97

EC:
2.7.7.56  

Functional Class:
Transcription; Degradation of RNA  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to ribonuclease PH (rph). Residues 1-238 are 78% similar to this enzyme from Pasteurella multocida (15603741|) and residues 1-236 are 78% similar to this enzyme from Haemophilus influenzae (16272231|).




COGS Summary:  COGS Search
BeTs to 9 clades of COG0689
COG name: RNase PH
Functional Class: J
The phylogenetic pattern of COG0689 is a-tkYq--ebrh--------x
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002381 (Ribonuclease PH) with a combined E-value of 5.7e-128.
    IPB002381A    2-22
    IPB002381B    47-94
    IPB002381C    96-137
    IPB002381D    174-209


ProDom Summary:  Protein Domain Search
Residues 126-236 are 75% similar to a (NUCLEOTIDYLTRANSFERASE COMPLETE PROTEOME) protein domain (PD002075) which is seen in RNPH_HAEIN.

Residues 2-125 are 65% similar to a (NUCLEOTIDYLTRANSFERASE COMPLETE PROTEOME) protein domain (PD333034) which is seen in RNPH_BACSU.

Residues 1-39 are 79% similar to a (TRNA NUCLEOTIDYLTRANSFERASE RIBONUCLEASE) protein domain (PD382995) which is seen in Q9CJW5_PASMU.

Residues 41-125 are 87% similar to a (NUCLEOTIDYLTRANSFERASE RIBONUCLEASE TRNA) protein domain (PD186441) which is seen in Q9CJW5_PASMU.



Paralogs:  Local Blast Search


HD0301 is paralogously related to HD1588 (2e-05).


Pfam Summary:  Pfam Search
Residues 10 to 143 (E-value = 3.9e-55) place HD0301 in the RNase_PH family which is described as 3' exoribonuclease family, domain 1 (PF01138)
Residues 157 to 224 (E-value = 5.4e-19) place HD0301 in the RNase_PH_C family which is described as 3' exoribonuclease family, domain 2 (PF03725)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MRPNHRENNQIRPVKITRHYTRYAEGSVLIEFGETKVLCNASIEESVPRF
LKGQQQGWVTAEYGMLPRATHSRNQREAAKGKQSGRTMEIQRLIARALRA
VVDLEALGERTITIDCDVIQADGGTRTAAITGACVALQDAIHKLIADGVL
KTNPLKGLVAAISVGIVENEAVCDLEYVEDAKAETDMNVVMVEDGRLVEV
QGTAEGKPFSHMELLQLLDLADQGINQLFEVQRQALAE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCGTCCCAATCATCGCGAAAATAATCAAATTCGCCCGGTAAAAATTAC
ACGCCATTATACTCGCTACGCCGAGGGATCGGTGTTAATTGAATTCGGTG
AGACCAAAGTATTATGCAATGCCAGCATAGAAGAATCTGTTCCACGCTTT
CTGAAAGGACAACAGCAAGGTTGGGTAACTGCGGAATATGGTATGTTACC
ACGCGCGACCCACAGCAGAAACCAACGTGAAGCCGCTAAAGGGAAACAAA
GTGGAAGAACCATGGAAATCCAACGCTTAATTGCCCGCGCTTTACGTGCC
GTAGTAGATTTGGAAGCATTAGGTGAGCGGACTATTACCATCGATTGTGA
TGTTATTCAAGCAGATGGTGGCACACGTACTGCCGCTATTACCGGTGCTT
GTGTCGCACTACAAGATGCAATTCATAAATTAATCGCTGATGGAGTACTG
AAAACCAATCCACTGAAAGGATTAGTCGCTGCGATTTCTGTCGGTATTGT
TGAAAATGAAGCTGTCTGCGATTTAGAATACGTAGAAGATGCTAAAGCAG
AAACTGATATGAATGTTGTGATGGTGGAAGACGGTCGATTAGTTGAAGTA
CAAGGCACAGCTGAAGGCAAACCTTTTTCACATATGGAATTACTGCAATT
ATTAGATCTTGCTGATCAAGGTATCAATCAATTATTTGAGGTTCAACGCC
AAGCATTAGCTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy