Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR215 IGR212 IGR210 IGR208 IGR214 IGR206 IGR216 IGR207 IGR211 IGR213 IGR209 HD0297 tpn, - HD0290 rph, - HD0301 grx, - HD0300 HD0292 tpn, - HD0295 HD0296 HD0298 HD0294 mod, - HD0293 bipA,typA, - HD0299 HD0297 tpn, - HD0290 rph, - HD0301 grx, - HD0300 HD0292 tpn, - HD0295 HD0296 HD0298 HD0294 mod, - HD0293 bipA,typA, - HD0299 Type: tandem, Name:  - 7 Type: tandem, Name:  - 8 HD0297 tpn, - HD0290 rph, - HD0301 tpn, - HD0291 tpn, - HD0291 grx, - HD0300 HD0292 tpn, - HD0295 HD0296 HD0298 HD0294 mod, - HD0293 bipA,typA, - HD0299
* Calculated from Protein Sequence

Gene ID: HD0296

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
hypothetical protein

Gene Start:
227680

Gene Stop:
228171

Gene Length:
492

Molecular Weight*:
19060

pI*:
5.20

Net Charge*:
-3.65

EC:
 

Functional Class:
Hypothetical  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search


COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0296 is paralogously related to HD1688 (3e-92) and HD1618 (1e-24).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKLRNMENSPINTDLAVMDYEEFKCFMKELATMYSDISDNGYPLLYDTLR
KISKAIATRPFEYHIIYGAYEIANKQVVVAIFEMQFNETNLGRTSVSFAE
DKLHLNCPSKVRKQLTQQDYITSAESAYPCIMEEMLFDKIRERREKERRS
VTPLTKEELEALS$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAACTACGTAATATGGAAAATTCACCGATTAATACCGATTTAGCCGT
AATGGATTATGAAGAATTTAAGTGCTTTATGAAAGAATTAGCCACAATGT
ATTCCGATATATCAGATAATGGCTACCCATTACTTTATGATACTTTACGA
AAAATCAGTAAGGCGATAGCCACACGTCCTTTTGAATACCATATTATTTA
TGGAGCGTATGAAATCGCCAATAAACAAGTGGTAGTCGCTATTTTTGAAA
TGCAATTTAATGAAACAAATCTCGGTCGTACTTCCGTCAGTTTTGCCGAA
GATAAACTGCATTTAAATTGTCCGTCCAAAGTCCGAAAACAACTTACCCA
ACAGGACTATATCACTTCCGCAGAGAGCGCCTATCCTTGCATTATGGAAG
AAATGCTATTTGATAAAATTCGAGAAAGACGAGAAAAGGAAAGAAGAAGT
GTAACCCCTTTAACCAAAGAGGAATTAGAAGCACTTAGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy