Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR215 IGR212 IGR210 IGR208 IGR214 IGR206 IGR207 IGR211 IGR213 IGR209 HD0297 tpn, - HD0290 rph, - HD0301 grx, - HD0300 HD0292 tpn, - HD0295 HD0296 HD0298 HD0294 mod, - HD0293 bipA,typA, - HD0299 HD0297 tpn, - HD0290 rph, - HD0301 grx, - HD0300 HD0292 tpn, - HD0295 HD0296 HD0298 HD0294 mod, - HD0293 bipA,typA, - HD0299 Type: tandem, Name:  - 7 Type: tandem, Name:  - 8 HD0297 tpn, - HD0290 rph, - HD0301 tpn, - HD0291 HD0289 tpn, - HD0291 HD0289 grx, - HD0300 HD0292 tpn, - HD0295 HD0296 HD0298 HD0294 mod, - HD0293 bipA,typA, - HD0299
* Calculated from Protein Sequence

Gene ID: HD0295

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tpn  

Definition:
transposase

Gene Start:
227272

Gene Stop:
227634

Gene Length:
363

Molecular Weight*:
13815

pI*:
9.40

Net Charge*:
7.67

EC:
 

Functional Class:
Other categories; Transposase  

Pathway: pathway table

Primary Evidence:
NULL

Secondary Evidence:
NULL

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 4-114 are 37% similar to >21243959 transposase [Xanthomonas axonopodis pv. citri str. 306]. Otherwise a significant hit in gapped BLAST to putative transposase protein; e.g. residues 49-117 are 31% similar to (AF225215) putative transposase of Xanthomonas oryzae pv. oryzae,

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0295 is paralogously related to HD1689 (4e-66), HD1616 (5e-38), HD1695 (7e-25), HD0291 (7e-25) and HD1612 (2e-24).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LFSMAQHFSLSAKARHLSIQVDELSDVEILSLLKTARWGNADNINDIECP
HCHVRHEAYFIKTRQQWQCKHCCYRFSITAGTIFHLAKLSLRKILKALRY
FALKSKGLSAIELSHEVSTF$

Gene Nucleotide Sequence:  Sequence Viewer
TTGTTTTCTATGGCACAGCATTTTTCGCTATCTGCAAAGGCACGCCACTT
GTCTATACAAGTGGACGAGCTTTCTGATGTCGAAATTTTGTCGTTGCTGA
AAACTGCTCGTTGGGGCAATGCTGATAATATAAATGATATTGAATGTCCG
CATTGTCACGTTAGACACGAAGCCTACTTCATTAAAACTCGCCAACAATG
GCAATGTAAGCATTGTTGCTATCGCTTTTCAATTACTGCAGGCACAATAT
TTCACCTTGCTAAATTATCACTGCGGAAGATATTAAAAGCCTTACGTTAT
TTTGCACTTAAAAGCAAAGGATTATCTGCCATTGAGCTTTCTCACGAAGT
ATCAACGTTCTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy