Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR205 IGR204 IGR212 IGR210 IGR208 IGR206 IGR207 IGR211 IGR213 IGR209 HD0297 tpn, - HD0290 HD0292 tpn, - HD0295 HD0288 HD0287 HD0296 HD0298 HD0294 mod, - HD0293 bipA,typA, - HD0299 HD0297 tpn, - HD0290 HD0292 tpn, - HD0295 HD0288 HD0287 HD0296 HD0298 HD0294 mod, - HD0293 bipA,typA, - HD0299 Type: tandem, Name:  - 7 Type: tandem, Name:  - 8 HD0297 tpn, - HD0290 tpn, - HD0291 HD0289 tpn, - HD0291 HD0289 HD0292 tpn, - HD0295 HD0287 HD0296 HD0298 HD0294 mod, - HD0293 bipA,typA, - HD0299 HD0288
* Calculated from Protein Sequence

Gene ID: HD0294

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein

Gene Start:
225931

Gene Stop:
226923

Gene Length:
993

Molecular Weight*:
38262

pI*:
4.70

Net Charge*:
-11.63

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 139-326 are 30% similar to residues 150-331 of >7515492 hypothetical protein A - Staphylococcus aureus phage phi-42.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 167-326 are 32% similar to a (DOMAIN OF UNKNO N) protein domain (PD306187) which is seen in Q38085_VVVVV.



Paralogs:  Local Blast Search
HD0294 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MPKDLFQPNASTSTAIAVFETYVSHNFDKDVVFYDLQDDGFILSKNKGRT
DIYNKWNFIESELLDEILNGSKSDDIVISRVRIKKNDEWNIYAHSQPDYS
KLNSQDFCNTINNYVIYQSKKELGLLEEDKTEFEMINVLSSYILEKNKIN
PKYQCKANLELFDKNRKWEYFKISDVFDRIEPTRGTTTYDLTEGNEIPYI
AAKKKNNGFDYFVSEDGNEEYISDGNGIGIGIVFINLGDGSGGYSVYQAE
RFIGMNGKTSVGYSDYLNQYNALFLITILDKQRYKYSFGRSWTGQRFDQT
KLYLPCKDNGSIDWEFMEDYIRSLPNGNII$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCCTAAAGATCTCTTTCAACCCAATGCATCTACTAGTACAGCTATTGC
GGTTTTTGAAACTTATGTATCTCACAATTTTGATAAAGATGTAGTTTTTT
ATGATTTGCAAGATGATGGTTTCATCCTTTCTAAAAATAAAGGGCGTACA
GATATATATAACAAGTGGAATTTTATAGAATCTGAATTGCTAGACGAAAT
CTTAAATGGTTCTAAGTCTGACGATATTGTTATTTCTAGAGTTAGAATCA
AAAAAAATGATGAATGGAATATTTACGCACATTCTCAGCCTGATTATAGT
AAATTAAATTCTCAAGATTTCTGTAATACTATTAATAATTACGTCATCTA
TCAAAGCAAAAAGGAATTAGGTCTTCTTGAAGAAGATAAAACAGAGTTTG
AAATGATTAATGTTTTATCTAGTTATATTTTAGAGAAAAACAAAATAAAT
CCTAAATATCAATGTAAAGCTAACTTAGAACTATTTGATAAAAATAGAAA
ATGGGAATATTTCAAAATTAGTGATGTTTTTGACAGAATTGAACCTACAA
GAGGCACTACAACTTATGATTTAACTGAAGGTAATGAAATCCCTTATATA
GCAGCTAAAAAGAAAAATAATGGATTTGATTATTTTGTATCTGAAGATGG
AAATGAAGAGTATATATCTGATGGTAATGGTATTGGTATTGGTATTGTGT
TTATTAATTTAGGGGATGGAAGTGGAGGATACTCAGTGTATCAAGCAGAG
CGTTTTATTGGTATGAATGGAAAAACATCTGTTGGCTACTCGGATTACCT
TAATCAATATAATGCTTTATTTTTAATAACTATCTTAGATAAGCAACGCT
ACAAATATTCTTTTGGTAGAAGTTGGACTGGACAGAGATTTGATCAAACT
AAATTATATTTACCTTGTAAAGATAATGGTAGTATAGATTGGGAATTTAT
GGAGGATTATATACGCTCTCTTCCTAATGGAAATATTATTTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy