Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR205 IGR204 IGR210 IGR200 IGR202 IGR203 IGR208 IGR201 IGR206 IGR207 IGR211 IGR209 HD0297 tpn, - HD0290 HD0292 tpn, - HD0295 HD0288 stfF,papF, - HD0285 HD0287 HD0296 HD0286 stfD, - HD0284 HD0294 mod, - HD0293 stfC,papC, - HD0283 HD0297 tpn, - HD0290 HD0292 tpn, - HD0295 HD0288 stfF,papF, - HD0285 HD0287 HD0296 HD0286 stfD, - HD0284 HD0294 mod, - HD0293 stfC,papC, - HD0283 Type: tandem, Name:  - 7 Type: tandem, Name:  - 8 HD0297 tpn, - HD0290 tpn, - HD0291 HD0289 tpn, - HD0291 HD0289 HD0292 tpn, - HD0295 HD0288 stfF,papF, - HD0285 HD0296 HD0286 stfD, - HD0284 HD0294 mod, - HD0293 stfC,papC, - HD0283 HD0287
* Calculated from Protein Sequence

Gene ID: HD0291

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tpn  

Definition:
transposase

Gene Start:
223834

Gene Stop:
223367

Gene Length:
468

Molecular Weight*:
17599

pI*:
10.00

Net Charge*:
11.10

EC:
 

Functional Class:
Other categories; Transposase  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 36 to 150 are 27% ( EScore : 1e-09 ) identical to gb|AAF65225.1|AF249895_1 putative transposase between residues 34 and 149 in [Xanthomonas pv. mangiferaeindicae]
Residues 35 to 150 are 24% ( EScore : 2e-09 ) identical to gb|AAF61102.1|AF225215_1 putative transposase between residues 33 and 149 in [Xanthomonas oryzae pv. oryzae]

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 35-150 are 24% similar to a (MEMBRANE OUTER TRANSPOSASE TBUX) protein domain (PD039757) which is seen in Q9L792_BBBBB.



Paralogs:  Local Blast Search
HD0291 is paralogously related to HD1695 (2e-91), HD1612 (8e-74), HD1616 (4e-37), HD1689 (9e-35) and HD0295 (1e-24).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MAQHFLLNSKAKTLSTLQIARLSDEQAFDLLCDMRWGSKQHVTCPKCGVQ
HQAYFIASHKQWRCKHCHHTFSVTSGTIFANRKASIQTYLYVLARFVNAV
KGVSALEISRDAKINYRTAFVLCHKLRKALLENRDMHPLSGEVDMDGTYV
HPAPP$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGCTCAACACTTCCTCTTAAACTCAAAAGCAAAAACGCTTTCTACGTT
ACAGATAGCCCGCCTATCTGACGAACAAGCGTTCGACTTGCTTTGTGATA
TGCGTTGGGGAAGTAAACAGCACGTAACGTGTCCTAAATGCGGTGTACAA
CATCAAGCCTATTTTATTGCTAGTCATAAACAATGGCGTTGCAAACATTG
TCATCATACCTTTTCAGTGACATCAGGCACAATCTTTGCCAACCGTAAGG
CTTCCATTCAAACCTACTTGTATGTATTAGCTCGTTTTGTGAATGCGGTT
AAGGGCGTATCTGCACTAGAAATCTCTCGTGACGCTAAAATTAATTATCG
TACAGCTTTTGTGCTTTGTCATAAATTGCGTAAAGCCTTGTTAGAAAATC
GAGATATGCACCCCCTTTCAGGCGAAGTTGATATGGACGGCACTTATGTT
CACCCTGCACCTCCGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy