Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR205 IGR204 IGR210 IGR200 IGR202 IGR203 IGR208 IGR201 IGR206 IGR207 IGR209 tpn, - HD0290 HD0292 tpn, - HD0295 stfF,papF, - HD0285 HD0288 HD0287 HD0296 HD0286 stfD, - HD0284 HD0294 mod, - HD0293 stfC,papC, - HD0283 tpn, - HD0290 HD0292 tpn, - HD0295 stfF,papF, - HD0285 HD0288 HD0287 HD0296 HD0286 stfD, - HD0284 HD0294 mod, - HD0293 stfC,papC, - HD0283 Type: tandem, Name:  - 7 Type: tandem, Name:  - 8 tpn, - HD0290 tpn, - HD0291 HD0289 tpn, - HD0291 HD0289 HD0292 stfF,papF, - HD0285 HD0288 HD0296 HD0286 stfD, - HD0284 HD0294 mod, - HD0293 stfC,papC, - HD0283 tpn, - HD0295 HD0287
* Calculated from Protein Sequence

Gene ID: HD0290

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
tpn  

Definition:
transposase (transposase fragment)

Gene Start:
223407

Gene Stop:
222796

Gene Length:
612

Molecular Weight*:
24417

pI*:
9.80

Net Charge*:
7.55

EC:
 

Functional Class:
Other categories; Transposase  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 25-201 are 37% similar to >21243959 transposase [Xanthomonas axonopodis pv. citri str. 306]. No other matches in gapped BLAST at this time.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0290 is paralogously related to HD1696 (1e-121), HD1612 (2e-97), HD1689 (3e-36) and HD1616 (2e-33).


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
LIWTALMFTLHLRKENKKIDRLDYRLKENKSPNKRCVMVAREHFSAEEKA
ENQFNRGAKRSHVFVTYSESQPVVKDFSNRFIVRESRINTDESTAYESLL
LDYDLRTVNHKEEYRSDLGITNNQAESFFSRFKRMYYGHVHKMSNLYLLN
YANEIAYREDNRRKANGWQSQDILGKCLTTTNENNEWCGYWQRKIVHQEV
IWQ$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATATGGACGGCACTTATGTTCACCCTGCACCTCCGTAAAGAAAACAA
GAAAATCGACCGCTTGGACTATCGCTTGAAAGAAAATAAAAGTCCTAATA
AACGCTGTGTTATGGTAGCTCGTGAACATTTTTCCGCAGAAGAAAAAGCA
GAAAACCAATTTAATCGCGGGGCAAAACGTTCACACGTTTTTGTGACTTA
TTCTGAATCACAACCTGTTGTAAAAGACTTCTCAAATCGCTTTATTGTTC
GTGAAAGTCGCATTAATACAGACGAAAGTACAGCTTACGAAAGTTTATTA
CTCGACTATGATTTACGCACAGTGAATCATAAAGAAGAATATCGTAGCGA
TTTAGGCATAACCAACAATCAAGCCGAATCCTTTTTCTCTCGCTTTAAAC
GAATGTACTACGGACACGTTCACAAAATGAGTAATCTTTATTTACTCAAC
TATGCAAATGAAATCGCTTACCGTGAAGATAATCGTAGAAAAGCCAATGG
TTGGCAATCTCAGGATATTCTCGGTAAATGCTTAACAACAACTAATGAAA
ATAACGAATGGTGCGGTTATTGGCAACGGAAAATCGTTCATCAAGAAGTG
ATTTGGCAGTAG


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy