Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR197 IGR205 IGR204 IGR198 IGR199 IGR200 IGR202 IGR203 IGR201 IGR206 IGR207 HD0280 tpn, - HD0290 HD0292 stfF,papF, - HD0285 HD0288 HD0287 papA, - HD0282 HD0286 fimA, - HD0281 stfD, - HD0284 mod, - HD0293 stfC,papC, - HD0283 HD0280 tpn, - HD0290 HD0292 stfF,papF, - HD0285 HD0288 HD0287 papA, - HD0282 HD0286 fimA, - HD0281 stfD, - HD0284 mod, - HD0293 stfC,papC, - HD0283 Type: tandem, Name:  - 7 HD0280 tpn, - HD0290 tpn, - HD0291 HD0289 tpn, - HD0291 HD0289 HD0292 stfF,papF, - HD0285 HD0288 papA, - HD0282 HD0286 fimA, - HD0281 stfD, - HD0284 mod, - HD0293 stfC,papC, - HD0283 HD0287
* Calculated from Protein Sequence

Gene ID: HD0285

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
stfF  papF  

Definition:
minor fimbrial subunit

Gene Start:
220241

Gene Stop:
220708

Gene Length:
468

Molecular Weight*:
17067

pI*:
5.70

Net Charge*:
-1.63

EC:
 

Functional Class:
Cell envelope; Surface structures  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 23 to 154 are 25% ( EScore : 4e-10 ) identical to gb|AAC64156.1| (AF093503) minor fimbrial subunit StfF between residues 29 and 157 in [Salmonella typhimurium]

Residues 2-154 are 30% similar to >16761730 fimbrial subunit [Salmonella enterica subsp. enterica serovar Typhi].

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 23-154 are 25% similar to a (OF COMPLETE SECTION BASES) protein domain (PD006228) which is seen in O87661_SALTY.



Paralogs:  Local Blast Search
HD0285 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
VLIIAKTSLAKNEHFDIQVVLTIQGTGCVVNNNQAIEINFGEMSPKNING
KAYEKVIPFDLQCNDPANTQYSLYFGRNNGADFVSSEYGVTLLATSNSNL
GLMIKRNGVPYPFDFSSTITEHSKQKLSVVPVVNQYAKLDVGPFTAFASM
VLEYY$

Gene Nucleotide Sequence:  Sequence Viewer
GTGCTAATAATAGCTAAAACTAGCTTAGCAAAAAACGAACATTTTGATAT
ACAAGTAGTTTTAACCATTCAAGGCACAGGTTGTGTCGTGAATAACAACC
AAGCTATAGAAATAAATTTTGGTGAAATGAGCCCAAAAAATATTAATGGA
AAAGCTTATGAGAAAGTAATCCCTTTTGATTTGCAATGTAATGATCCTGC
TAATACACAATATTCGTTATATTTTGGGAGAAACAATGGAGCAGATTTTG
TTTCAAGTGAATATGGAGTTACTTTACTAGCGACTAGCAACAGCAACTTG
GGGTTAATGATTAAACGCAATGGAGTCCCCTATCCGTTTGATTTTTCTTC
AACTATTACGGAACATAGCAAGCAAAAACTAAGTGTAGTTCCTGTAGTTA
ATCAATATGCTAAATTGGATGTAGGCCCTTTTACTGCTTTTGCATCAATG
GTTCTTGAATATTATTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy