Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR197 IGR191 IGR198 IGR199 IGR200 IGR193 IGR195 IGR194 IGR192 IGR196 HD0280 ribF, - HD0273 ileS, - HD0272 nadR, - HD0275 papA, - HD0282 HD0277 HD0279 fimA, - HD0281 arcA, - HD0278 stfD, - HD0284 nadR, - HD0274 stfC,papC, - HD0283 HD0280 ribF, - HD0273 ileS, - HD0272 nadR, - HD0275 papA, - HD0282 HD0277 HD0279 fimA, - HD0281 arcA, - HD0278 stfD, - HD0284 nadR, - HD0274 stfC,papC, - HD0283 HD0280 ribF, - HD0273 ileS, - HD0272 papA, - HD0282 HD0279 fimA, - HD0281 arcA, - HD0278 stfD, - HD0284 nadR, - HD0274 stfC,papC, - HD0283 HD0276 nadR, - HD0275 HD0277 HD0276
* Calculated from Protein Sequence

Gene ID: HD0279

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:


Definition:
conserved hypothetical protein (possible outer membrane protein)

Gene Start:
214483

Gene Stop:
215004

Gene Length:
522

Molecular Weight*:
18752

pI*:
10.50

Net Charge*:
10.94

EC:
 

Functional Class:
Unknown  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Residues 1-173 are 30% similar to 19911156 outer membrane protein 18/16 [Actinobacillus actinomycetemcomitans]. No other matches in gapped BLAST at this time.

COGS Summary:  COGS Search
No hits to the COGs database.

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
No significant hits to the ProDom database.

Paralogs:  Local Blast Search
HD0279 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MKNNVAILTLVGLFSVSAFAAPVGQTFTGMGIGIDLDTAKYTSHGQNGKR
KASPMIVLDYGMDYGNNLVGIVQAKAKLNRTKIANDLTQKNKYTVAYQQG
YRVGSDLLSYVKIDASQTKIGDTNYRGYGYGAGVKYAVSSNIEVGGEYTH
SHIKRNGNKLKGNELIAHVGYRF$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAAAAATAATGTAGCAATCTTAACGCTTGTTGGTTTATTCTCTGTATC
AGCATTTGCCGCACCAGTAGGTCAAACTTTTACTGGTATGGGAATAGGTA
TTGATTTAGACACAGCAAAATATACATCTCATGGTCAAAACGGCAAACGT
AAGGCTAGCCCAATGATCGTTTTAGATTATGGCATGGACTATGGCAATAA
TTTAGTGGGGATCGTGCAAGCAAAGGCTAAATTGAATAGAACAAAGATAG
CGAATGATTTAACTCAAAAAAATAAATACACGGTTGCTTATCAACAAGGT
TACCGTGTAGGTTCAGATTTATTGTCATATGTTAAAATTGATGCTAGCCA
AACTAAAATTGGCGATACGAATTATCGTGGTTATGGTTATGGCGCAGGTG
TGAAATATGCGGTATCAAGTAATATTGAAGTTGGCGGTGAATATACACAT
AGTCATATCAAAAGAAATGGTAACAAATTAAAAGGCAATGAATTAATTGC
ACATGTTGGTTATCGTTTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy