Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR189 IGR191 IGR193 IGR190 IGR195 IGR194 IGR192 IGR196 HD0280 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 nadR, - HD0275 HD0277 HD0279 arcA, - HD0278 nadR, - HD0274 HD0280 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 nadR, - HD0275 HD0277 HD0279 arcA, - HD0278 nadR, - HD0274 HD0280 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 HD0279 arcA, - HD0278 nadR, - HD0274 HD0276 nadR, - HD0275 HD0277 HD0276
* Calculated from Protein Sequence

Gene ID: HD0273

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ribF  

Definition:
riboflavin biosynthesis protein, ribF

Gene Start:
211131

Gene Stop:
210151

Gene Length:
981

Molecular Weight*:
37084

pI*:
10.40

Net Charge*:
13.98

EC:
2.7.1.26  

Functional Class:
Biosynthesis of cofactors, prosthetic groups, and carriers; Riboflavin  

Pathway: pathway table
Riboflavin metabolism

Primary Evidence:
NULL

Secondary Evidence:
NULL

Comment:
0

Blast Summary:  PSI-Blast Search
Residues 31 to 350 are 54% ( EScore : 4e-89 ) identical to sp|P44957|RIBF_HAEIN RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF between residues 1 and 307 in [INCLUDES: RIBOFLAVIN KINASE (FLAVOKINASE); FMN ADENYLYLTRANSFERASE (FAD PYROPHOSPHORYLASE) (FAD SYNTHETASE)]
Residues 31 to 350 are 54% ( EScore : 4e-89 ) identical to pir||H64162 hypothetical protein HI0963 between residues 5 and 311 in [Haemophilus influenzae Rd]
Residues 31 to 349 are 50% ( EScore : 3e-83 ) identical to sp|P08391|RIBF_ECOLI RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF [INCLUDES: RIBOFLAVIN KINASE between residues 1 and 307 in [Escherichia coli]
Residues 31 to 349 are 46% ( EScore : 2e-70 ) identical to gb|AAA24605.1| (M10428) protein X between residues 1 and 306 in [Escherichia coli]
Residues 31 to 345 are 46% ( EScore : 2e-70 ) identical to sp|P22990|RIBF_PSEFL RIBOFLAVIN BIOSYNTHESIS PROTEIN RIBF [INCLUDES: RIBOFLAVIN KINASE between residues 1 and 301 in [Pseudomonas fluorescens]
Residues 31 to 345 are 43% ( EScore : 8e-60 ) identical to gb|AAF42169.1| (AE002533) riboflavin kinase/FMN adenylyltransferase between residues 1 and 303 in [Neisseria meningitidis MC58]
Residues 20 to 345 are 41% ( EScore : 4e-58 ) identical to emb|CAB83911.1| (AL162753) putative riboflavin kinase/FMN adenylyltransferase between residues 2 and 315 in [Neisseria meningitidis]
Residues 48 to 345 are 37% ( EScore : 8e-52 ) identical to gb|AAF85218.1|AE004051_2 riboflavin biosynthesis protein between residues 16 and 302 in [Xylella fastidiosa]
Residues 40 to 343 are 34% ( EScore : 2e-47 ) identical to pir||D70313 riboflavin kinase - Aquifex aeolicus >2982868|gb|AAC06488.1| between residues 18 and 307 in [Aquifex aeolicus]
Residues 42 to 350 are 38% ( EScore : 7e-47 ) identical to emb|CAB55633.1| (AJ238888) riboflavin biosynthesis protein between residues 9 and 306 in [Gluconobacter oxydans]

COGS Summary:  COGS Search
BeTs to 11 clades of COG0196
COG name: FAD synthase
Functional Class:  H
The phylogenetic pattern of COG0196 is ----yqvceBrhujgp-lin-
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002606 (Riboflavin kinase / FAD synthetase) with a combined E-value of 1.4e-63.
    IPB002606A    25-34
    IPB002606B    57-71
    IPB002606C    129-143
    IPB002606D    206-227
    IPB002606E    235-242
    IPB002606F    251-263
    IPB002606G    269-311


ProDom Summary:  Protein Domain Search
Residues 1-41 are 70% similar to a (RIBOFLAVIN KINASE FAD TRANSFERASE) protein domain (PD186238) which is seen in Q9HVM3_PSEAE.

Residues 128-200 are 53% similar to a (RIBOFLAVIN KINASE FAD COMPLETE) protein domain (PD004889) which is seen in Q9CKF8_PASMU.

Residues 48-125 are 55% similar to a (RIBOFLAVIN PROTEOME FAD COMPLETE) protein domain (PD384466) which is seen in Q9CKF8_PASMU.

Residues 196-315 are 65% similar to a (RIBOFLAVIN KINASE FAD PROTEOME) protein domain (PD003662) which is seen in RIBF_HAEIN.

Residues 50-120 are 53% similar to a (KINASE RIBOFLAVIN FAD FMN) protein domain (PD394996) which is seen in RIBF_ECOLI.



Paralogs:  Local Blast Search

HD0273 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 18 to 181 (E-value = 1.3e-66) place HD0273 in the Flavokinase family which is described as Riboflavin kinase (Flavokinase) (PF06574)
Residues 197 to 320 (E-value = 4.5e-50) place HD0273 in the FAD_Synth family which is described as Riboflavin kinase / FAD synthetase (PF01687)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MQLIRGFHNLANYDALKKGCVLTIGNFDGVHIGHQNILARLCDQSLAIGL
PSVVMLFEPQPREFFAKNSQNQTASALSNAVPARLMRLRDKLKYLAEMGV
DFVLCVNFNQKFAKYSAEDFITELLVKKLKVRYLSVGDDFRFGIERRGNF
EMLRNAGLTHRFAVEESHTHRFDTLRISSSLIRQALQQNDLALVENLLGK
PYSIRGRVAHGNKLGRTIGFPTANIMLNRLVTPIQGVFIVEVQTIYGRFN
GIANVGNRPTINGTKPLLEVHIFDFNNAIYHQIIEVIFIKKIRDELKFAS
FTLLKEQIEKDCQQAVEFFNQLPKTK$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAATTAATCCGTGGCTTTCACAATTTAGCTAACTATGATGCACTAAA
AAAAGGTTGTGTATTAACCATTGGCAATTTTGATGGTGTACACATAGGCC
ATCAAAATATTTTAGCCCGTTTATGCGATCAATCATTAGCTATCGGTTTA
CCTTCAGTGGTTATGCTATTTGAACCTCAACCGCGTGAATTTTTTGCTAA
AAATAGCCAAAATCAGACCGCTAGCGCTCTATCCAACGCTGTACCAGCAA
GGCTAATGCGTTTACGCGATAAGCTGAAATATTTAGCTGAAATGGGGGTT
GATTTTGTACTTTGTGTCAATTTCAATCAAAAATTTGCGAAATATTCGGC
GGAAGATTTTATTACTGAATTATTGGTAAAAAAATTGAAAGTTCGTTATC
TTAGTGTTGGCGATGATTTTCGTTTTGGTATTGAACGTCGCGGTAATTTT
GAAATGCTACGAAATGCAGGCTTAACACATCGTTTTGCAGTTGAAGAAAG
CCACACTCATCGCTTTGATACACTCAGAATTAGTAGTTCATTAATCCGAC
AAGCGTTACAACAAAATGACTTAGCCTTAGTAGAAAATTTACTTGGTAAA
CCTTATTCAATCCGTGGACGTGTTGCTCACGGCAATAAACTCGGTAGAAC
AATTGGCTTCCCAACCGCAAACATTATGCTGAATCGGTTAGTAACGCCGA
TTCAAGGCGTGTTCATTGTAGAAGTTCAAACCATTTACGGGCGCTTCAAT
GGCATTGCTAATGTAGGAAATAGACCAACCATTAACGGCACAAAACCGTT
ATTAGAAGTACATATTTTTGACTTTAATAACGCTATTTATCATCAAATCA
TTGAAGTGATTTTTATAAAAAAAATCCGTGATGAACTAAAATTTGCTAGT
TTTACCTTACTAAAAGAGCAGATTGAAAAAGATTGTCAACAAGCGGTTGA
ATTTTTTAATCAATTACCCAAGACAAAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy