Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR189 IGR191 IGR193 IGR188 IGR190 IGR187 IGR194 IGR192 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 nadR, - HD0275 HD0277 arcA, - HD0278 nadR, - HD0274 obg, - HD0269 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 nadR, - HD0275 HD0277 arcA, - HD0278 nadR, - HD0274 obg, - HD0269 Type: tandem, Name:  - 6 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 arcA, - HD0278 nadR, - HD0274 obg, - HD0269 HD0276 nadR, - HD0275 HD0277 HD0276
* Calculated from Protein Sequence

Gene ID: HD0272

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
ileS  

Definition:
isoleucyl-tRNA synthetase

Gene Start:
210116

Gene Stop:
207309

Gene Length:
2808

Molecular Weight*:
105763

pI*:
6.10

Net Charge*:
-16.14

EC:
6.1.1.5  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Valine, leucine and isoleucine biosynthesis

Secondary Evidence:
Yanagisawa,T., Lee,J.T., Wu,H.C. and Kawakami,M.
Relationship of protein structure of isoleucyl-tRNA synthetase with pseudomonic acid resistance of Escherichia coli. A proposed mode of action of pseudomonic acid as an inhibitor of isoleucyl-tRNA synthetase
J. Biol. Chem. 269 (39), 24304-24309 (1994)
Medline: 95014171

Kamio,Y., Lin,C.K., Regue,M. and Wu,H.C.
Characterization of the ileS-lsp operon in Escherichia coli.
Identification of an open reading frame upstream of the ileS gene
and potential promoter(s) for the ileS-lsp operon
J. Biol. Chem. 260 (9), 5616-5620 (1985)
Medline: 85182715


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to isoleucyl-trna synthetases. Residues 3-935 are 76% similar to this enzyme from Haemophilus influenzae Rd (16273685|) and are 74% similar to this enzyme from Pasteurella multocida (15603527|).





COGS Summary:  COGS Search
BeTs to 17 clades of COG0060
COG name: Isoleucyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0060 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB001412 (Aminoacyl-transfer RNA synthetases class-I) with a combined E-value of 5.8e-10.
    IPB001412A    58-68
    IPB001412B    597-607


ProDom Summary:  Protein Domain Search
Residues 127-188 are 85% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA ATP-BINDING) protein domain (PD002670) which is seen in SYI_HAEIN.

Residues 704-785 are 90% similar to a (SYNTHETASE LIGASE ISOLEUCYL-TRNA) protein domain (PD023651) which is seen in SYI_HAEIN.

Residues 585-685 are 74% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000476) which is seen in SYI_ECOLI.

Residues 385-584 are 80% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000647) which is seen in Q9CKF7_PASMU.

Residues 304-374 are 41% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD004139) which is seen in Q9FI67_ARATH.

Residues 193-255 are 78% similar to a (SYNTHETASE LIGASE ISOLEUCYL-TRNA) protein domain (PD186111) which is seen in Q9CKF7_PASMU.

Residues 638-825 are 23% similar to a (CG5414) protein domain (PD276669) which is seen in Q9VUY4_DROME.

Residues 32-107 are 82% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA BIOSYNTHESIS) protein domain (PD000389) which is seen in Q9CKF7_PASMU.

Residues 317-382 are 78% similar to a (SYNTHETASE LIGASE ISOLEUCYL-TRNA) protein domain (PD000939) which is seen in Q9CKF7_PASMU.

Residues 815-925 are 65% similar to a (SYNTHETASE LIGASE ISOLEUCYL-TRNA) protein domain (PD009823) which is seen in SYI_HAEIN.

Residues 631-697 are 64% similar to a (SYNTHETASE PROTEOME ISOLEUCYL-TRNA) protein domain (PD210966) which is seen in Q9HVM4_PSEAE.

Residues 257-315 are 69% similar to a (SYNTHETASE LIGASE ISOLEUCYL-TRNA) protein domain (PD131012) which is seen in SYI_HAEIN.

Residues 1-42 are 64% similar to a (SYNTHETASE ISOLEUCYL-TRNA LIGASE) protein domain (PD003203) which is seen in Q9HVM4_PSEAE.



Paralogs:  Local Blast Search


HD0272 is paralogously related to HD0669 (6e-43), HD1132 (2e-16) and HD1054 (3e-05).


Pfam Summary:  Pfam Search
Residues 27 to 639 (E-value = 6.9e-286) place HD0272 in the tRNA-synt_1 family which is described as tRNA synthetases class I (I, L, M and V) (PF00133)
Residues 895 to 924 (E-value = 1.5e-12) place HD0272 in the zf-FPG_IleRS family which is described as Zinc finger found in FPG and IleRS (PF06827)

PDB Hit:
pdb|1FFY|A Chain A, Insights Into Editing From An Ile-Trna Synt... 765 0.0
pdb|1ILE| Isoleucyl-Trna Synthetase 351 2e-097
pdb|1GAX|A Chain A, Crystal Structure Of Thermus Thermophilus V... 203 1e-052

Gene Protein Sequence:
MTDYKDTLNLPETGFPMRGDLAKREPAMLKNWYDKNLYQQIRQTSKGKKT
FILHDGPPYANGNLHLGHAVNKILKDIIMKSKTASGFDTPYVPGWDCHGL
PIELKVESIVGKPNEKISAAEFRQACREYANEQVDRQKADFIRMGVLGDW
DNPYLTMNFNTEASIIRTLAKVIANGHLYKGSKPVHWCLDCGSSLAEAEV
EYEDKVSPSIYVRFKACDETAIETLFNAKGNGPISAIIWTTTPWTMPSNR
AIAIHPELEYALVQLADERVILATELVESVAKAIEAESFDILATVKGETL
QLLRFHHPFYAFDVPFIFGDHVTTEGGTGLVHTAPDHGTDDFIIARKNNI
EMAGLIGNDGKFKSDVEFFAGLAVFESNEKVIEKLKETGALLKLARIKHS
YPHCWRHKTPIIFRATPQWFIGMEKQGLRAQALAEIKTVRWIPNWGEARI
DTMVANRPDWCISRQRTWGVPMAMFVHNETEELHPRTLDILELVAQRVEQ
QGIQAWWDLDPTEVLGEDAQHYHKVPDTLDVWFDSGSTYASVVEQRPEFN
GQTADMYLEGSDQHRGWFMSSLMLASATNGKAPYQQVLTHGFVVDEKGRK
MSKSIGNVIVPSEVWNKNGADILRLWVASTDYTAEMKVSHGILNSAGDAY
RRIRNTARFLLSNLNGFIPARDEVKPNEMIALDRWAVSCALEAQNDIIEA
YEHYQFHTVVQRLMRFCSIEMGSFYLDIIKDRQYTTKADSLARRSCQTAL
WHIAEALVRWIAPILSFTADEIWSHLPTVEGRSEFVFTEQFYSQLFTLNC
HDKLDDNYWQQLINIRAEVNRVLEQARNEKTIGAGLEAKVTVYANDEMLP
LLHQLGNELRFVLITSQAIVKPLSEADVAEGELAGLAVKVERAEGEKCPR
CWHFATDIGTHAEHNAICGRCVENVAGKGEVRRFA$

Gene Nucleotide Sequence:  Sequence Viewer
ATGACCGACTATAAAGATACATTAAACTTACCTGAAACAGGGTTTCCTAT
GCGTGGCGATCTTGCCAAACGCGAACCTGCAATGCTAAAGAATTGGTATG
ACAAAAATTTATACCAACAAATCCGCCAAACCTCTAAAGGCAAAAAAACC
TTTATTCTGCATGATGGTCCTCCCTATGCAAATGGCAATCTCCACTTAGG
TCACGCTGTTAATAAAATTTTAAAAGATATTATTATGAAGTCAAAAACCG
CCTCTGGTTTTGATACTCCTTATGTACCAGGCTGGGATTGCCATGGCTTA
CCGATTGAATTAAAAGTCGAAAGTATTGTGGGTAAACCTAATGAAAAAAT
CAGTGCTGCTGAATTCCGCCAAGCGTGCCGTGAATATGCGAATGAACAAG
TCGATAGACAAAAAGCAGATTTTATTCGTATGGGCGTGTTAGGTGATTGG
GATAATCCATATTTAACCATGAATTTTAACACTGAAGCGAGCATTATCCG
TACTTTGGCTAAAGTAATTGCTAACGGCCATTTATATAAAGGTTCTAAAC
CGGTGCATTGGTGTTTAGACTGCGGATCGTCTTTAGCCGAAGCCGAAGTA
GAATATGAAGACAAAGTTTCACCTTCTATTTATGTTCGTTTTAAAGCCTG
CGATGAAACTGCAATTGAAACCCTATTCAACGCCAAAGGGAATGGGCCAA
TTTCAGCAATTATTTGGACAACAACACCTTGGACAATGCCATCTAACCGT
GCTATTGCAATTCATCCCGAACTTGAATATGCGCTCGTTCAACTTGCTGA
TGAACGGGTAATTTTAGCAACTGAACTCGTTGAATCAGTAGCCAAGGCGA
TTGAAGCGGAATCCTTTGATATTTTAGCAACGGTCAAAGGCGAAACATTG
CAATTATTACGTTTTCACCATCCATTCTATGCTTTTGATGTACCATTCAT
TTTTGGCGATCACGTGACTACTGAAGGTGGTACTGGTTTGGTACATACTG
CGCCTGATCATGGTACAGATGACTTTATTATTGCACGTAAAAACAACATT
GAAATGGCCGGTTTAATTGGCAACGATGGTAAATTCAAATCAGATGTTGA
ATTTTTTGCTGGATTAGCCGTATTTGAATCAAATGAGAAAGTTATTGAAA
AATTAAAAGAAACAGGCGCATTATTAAAATTAGCCCGCATCAAACATAGC
TATCCACATTGTTGGCGCCATAAAACACCGATCATATTCCGCGCTACGCC
ACAATGGTTTATTGGTATGGAAAAACAAGGCTTACGTGCTCAAGCGTTAG
CTGAAATTAAAACGGTCCGTTGGATCCCAAACTGGGGTGAAGCGCGGATT
GATACTATGGTTGCTAACCGCCCTGATTGGTGTATTTCACGCCAGCGTAC
TTGGGGTGTACCTATGGCCATGTTCGTACATAATGAAACAGAAGAACTAC
ATCCTCGCACATTAGACATTCTCGAATTAGTGGCGCAACGTGTTGAACAA
CAAGGAATCCAAGCTTGGTGGGATTTAGATCCTACCGAAGTATTAGGTGA
AGATGCACAACATTATCACAAAGTACCAGACACTTTAGACGTATGGTTTG
ATTCTGGCTCAACTTATGCCTCTGTAGTAGAACAACGCCCAGAGTTTAAC
GGTCAAACAGCCGATATGTATCTTGAAGGTTCAGATCAACATCGTGGTTG
GTTTATGTCTTCATTAATGCTTGCCAGTGCAACAAATGGCAAAGCACCGT
ATCAGCAAGTATTAACACATGGCTTTGTGGTTGATGAAAAAGGTCGCAAA
ATGTCAAAATCGATCGGTAACGTTATTGTACCGTCAGAAGTATGGAACAA
AAACGGAGCAGATATTTTACGCCTATGGGTTGCCTCAACCGATTACACCG
CTGAAATGAAAGTATCACACGGTATCTTAAACAGTGCTGGAGATGCTTAT
CGCCGTATTCGTAACACCGCTCGTTTTTTATTATCTAATTTAAATGGCTT
CATTCCAGCACGTGACGAAGTCAAGCCAAATGAGATGATTGCTTTAGATC
GTTGGGCAGTGAGTTGTGCATTGGAAGCACAAAACGATATTATCGAAGCC
TATGAGCATTATCAATTCCACACTGTAGTGCAACGCCTAATGCGTTTTTG
CTCAATCGAAATGGGATCATTCTACTTAGATATTATTAAAGATCGCCAAT
ATACAACCAAAGCTGATAGTCTTGCACGTCGCAGTTGCCAAACGGCACTA
TGGCATATTGCTGAAGCGCTTGTACGTTGGATTGCACCTATTCTTTCATT
TACTGCTGATGAAATTTGGAGCCATTTACCGACGGTAGAAGGCAGATCTG
AATTTGTCTTTACCGAACAATTTTATAGCCAATTATTTACCCTAAACTGC
CACGATAAATTAGATGATAATTACTGGCAACAATTAATTAATATTCGAGC
AGAAGTTAATCGGGTTTTAGAACAAGCACGTAATGAAAAAACTATCGGTG
CAGGTTTAGAAGCAAAAGTGACAGTTTATGCTAACGATGAAATGCTACCA
TTATTACACCAATTAGGTAATGAACTTCGTTTTGTATTAATTACCTCACA
AGCCATTGTCAAACCACTAAGTGAGGCTGATGTTGCAGAAGGTGAATTAG
CAGGTTTAGCGGTCAAGGTGGAACGAGCAGAAGGTGAGAAATGCCCACGT
TGTTGGCATTTTGCGACAGATATCGGCACACACGCTGAACATAATGCAAT
ATGTGGACGCTGTGTAGAAAACGTAGCAGGCAAAGGTGAAGTCCGCCGTT
TTGCATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy