Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR189 IGR191 IGR188 IGR186 IGR190 IGR187 IGR192 HD0267 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 nadR, - HD0274 obg, - HD0269 argS, - HD0268 HD0267 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 nadR, - HD0274 obg, - HD0269 argS, - HD0268 Type: tandem, Name:  - 6 HD0267 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 nadR, - HD0274 obg, - HD0269 argS, - HD0268
* Calculated from Protein Sequence

Gene ID: HD0271

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
pssA  

Definition:
phosphatidylserine synthetase

Gene Start:
207207

Gene Stop:
205843

Gene Length:
1365

Molecular Weight*:
52566

pI*:
10.20

Net Charge*:
14.90

EC:
2.7.8.8  

Functional Class:
Fatty acid and phospholipid metabolism  

Pathway: pathway table
Glycerolipid metabolism
Glycine, serine and threonine metabolism

Secondary Evidence:
Dowhan,W.
Phosphatidylserine synthase from Escherichia coli
Meth. Enzymol. 209, 287-298 (1992)
MEDLINE: 92356873

Saha SK, Nishijima S, Matsuzaki H, Shibuya I, Matsumoto K.
A regulatory mechanism for the balanced synthesis of membrane phospholipid species in Escherichia coli.
Biosci Biotechnol Biochem. 1996 Jan;60(1):111-6.
PMID: 8824831


Comment:
0

Blast Summary:  PSI-Blast Search
Residues 2 to 454 are 55% ( EScore : 1e-146 ) identical to sp|P44704|PSS_HAEIN CDP-DIACYLGLYCEROL--SERINE O-PHOSPHATIDYLTRANSFERASE between residues 1 and 455 in [Haemophilus influenzae Rd]
Residues 1 to 454 are 48% ( EScore : 1e-129 ) identical to sp|P23830|PSS_ECOLI between residues 1 and 451
Residues 1 to 454 are 48% ( EScore : 1e-129 ) identical to pir||H65036 CDPdiacylglycerol--serine O-phosphatidyltransferase between residues 2 and 452 in [Escherichia coli]
Residues 1 to 454 are 48% ( EScore : 1e-129 ) identical to dbj|BAA16470.1| (D90886) CDP-DIACYLGLYCEROL--SERINE O-PHOSPHATIDYLTRANSFERASE between residues 8 and 458 in [Escherichia coli]
Residues 1 to 454 are 47% ( EScore : 1e-123 ) identical to pir||JH0368 CDPdiacylglycerol--serine O-phosphatidyltransferase between residues 1 and 452 in [Escherichia coli]
Residues 15 to 454 are 47% ( EScore : 1e-118 ) identical to gb|AAF74310.1|AF070946_1 phosphatidylserine synthase between residues 9 and 446 in [Vibrio parahaemolyticus]
Residues 21 to 393 are 22% ( EScore : 8e-16 ) identical to gb|AAF55593.1| (AE003723) CG7718 gene product between residues 55 and 444 in [Drosophila melanogaster]
Residues 23 to 393 are 23% ( EScore : 3e-13 ) identical to sp|P79001|PEL1_SACPS PUTATIVE CDP-DIACYLGLYCEROL--SERINE O-PHOSPHATIDYLTRANSFERASE between residues 60 and 468 in [Saccharomyces pastorianus]
Residues 26 to 393 are 23% ( EScore : 2e-12 ) identical to emb|CAB88571.1| (AL353820) probable PEL1 between residues 40 and 444 in [Neurospora crassa]
Residues 23 to 350 are 23% ( EScore : 4e-07 ) identical to ref|NP_009923.1|| 17 kDa phosphatidylglycerolphosphate synthase; Pgs1p >2146827|pir||S74289 hypothetical protein YCL004w - yeast between residues 60 and 408 in [Saccharomyces cerevisiae]

COGS Summary:  COGS Search
BeTs to 3 clades of COG1502
COG name: Cardiolipin synthase, phoaphatidylserine synthase and related enzymes of the phospholipase D family
Functional Class:  I
The phylogenetic pattern of COG1502 is a---y-vcEB-hUJ----INx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 189-431 are 54% similar to a (O-PHOSPHATIDYLTRANSFERASE) protein domain (PD329347) which is seen in PSS_HAEIN.

Residues 19-187 are 57% similar to a (SYNTHASE PHOSPHATIDYLSERINE) protein domain (PD014389) which is seen in PSS_HAEIN.



Paralogs:  Local Blast Search

HD0271 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 355 to 382 (E-value = 3.8e-07) place HD0271 in the PLDc family which is described as Phospholipase D. Active site motif (PF00614)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLIINKLNHAQKQLEKLNFIPQQADKVDFLASSSEFKARILQLINTAKSR
IYLTALYFEQDEAGQQILAALYQAKLANPALDIQILVDWHRAQRGRIGEK
TTSSNADWYANMKQQYNLPPEQEIAVWGVPINGREIFGVLHLKGFIFDDT
ILYSGASINNVYLQQFDRYRYDRYHTLENKVLADSLVTFLQQHILTDHAV
NRLDNMQRPVTANIRPAIKAFRKQLTKQQYQFAEQPESNGLMLSPIAGLG
RKNQLNKTIEALFYKTQNKLTICTPYFNFPRSLITRIKWLLENGKQVEII
AGDKKANDFYTPPDKKFTMAAALPYLYEKNLRAFAKRFDSYIQNKLLTIR
LWKDGENTYHLKGLWVDNRYILLTGNNLNPRAWGLDAENGILLDDPKAEL
AEKAALELTQIRTFTQELSHYSDLETIKDYPLEVQKLLKKFGRVKLDKII
KMLL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCTTATTATAAATAAACTTAACCATGCTCAAAAACAGCTAGAGAAACT
CAACTTTATCCCTCAGCAAGCAGACAAAGTTGATTTCCTAGCAAGTAGTA
GCGAGTTTAAAGCACGCATTTTACAGCTTATCAACACCGCAAAATCTCGC
ATTTATTTGACCGCTTTATACTTTGAACAAGATGAAGCAGGTCAACAAAT
TTTAGCGGCATTATATCAAGCAAAATTAGCTAACCCTGCATTAGATATCC
AAATTTTAGTAGATTGGCACCGAGCACAAAGAGGGCGTATTGGTGAAAAA
ACCACGTCCTCAAACGCTGATTGGTACGCGAATATGAAACAGCAATATAA
TCTTCCGCCCGAACAAGAGATTGCTGTTTGGGGCGTTCCAATTAATGGCA
GAGAAATCTTTGGTGTACTCCATTTAAAAGGTTTTATCTTTGACGATACC
ATTCTATATAGCGGTGCTAGCATTAATAACGTCTATTTACAACAATTCGA
CCGCTACCGTTACGATCGCTATCATACCCTTGAAAATAAAGTATTAGCTG
ACAGCTTAGTCACCTTTTTACAGCAACATATTTTGACTGATCACGCCGTT
AATCGGTTGGATAATATGCAACGACCTGTAACGGCGAATATTCGTCCCGC
CATTAAAGCGTTCCGTAAACAATTAACTAAACAACAATATCAATTTGCTG
AACAGCCAGAAAGTAACGGATTAATGCTTTCGCCTATTGCAGGGCTTGGA
CGTAAAAATCAATTAAACAAAACCATTGAAGCGTTATTCTATAAAACACA
AAACAAGCTCACAATTTGTACACCATATTTCAATTTTCCACGTTCATTAA
TCACTCGGATAAAATGGTTGCTCGAAAATGGAAAACAAGTGGAAATTATT
GCGGGTGATAAAAAAGCGAATGATTTTTACACGCCACCAGACAAAAAATT
TACTATGGCGGCGGCATTGCCTTACCTATATGAAAAAAATCTAAGGGCGT
TTGCAAAGCGTTTTGACAGTTACATACAGAATAAACTATTGACTATACGT
TTATGGAAAGATGGTGAAAATACTTACCATCTAAAAGGATTATGGGTAGA
TAACCGCTATATTTTATTGACTGGTAATAATTTAAACCCTCGTGCGTGGG
GCTTAGATGCTGAGAATGGAATTTTACTTGATGATCCAAAAGCAGAGTTA
GCTGAAAAAGCTGCCCTTGAATTAACACAAATCCGTACATTTACTCAAGA
GCTTAGCCATTATAGCGACTTAGAAACGATTAAAGATTATCCGCTTGAAG
TTCAAAAATTATTAAAAAAATTTGGTCGAGTCAAATTAGATAAAATCATC
AAAATGTTATTGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy