Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR185 IGR189 IGR191 IGR184 IGR188 IGR186 IGR190 IGR187 lpp, - HD0266 HD0267 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 mdh, - HD0264 obg, - HD0269 argS, - HD0268 lpp, - HD0266 HD0267 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 mdh, - HD0264 obg, - HD0269 argS, - HD0268 Type: tandem, Name:  - 6 lpp, - HD0266 HD0267 spoU,trmH, - HD0270 ribF, - HD0273 pssA, - HD0271 ileS, - HD0272 mdh, - HD0264 obg, - HD0269 argS, - HD0268
* Calculated from Protein Sequence

Gene ID: HD0270

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
spoU  trmH  

Definition:
tRNA/rRNA methyltransferase

Gene Start:
205810

Gene Stop:
205070

Gene Length:
741

Molecular Weight*:
26819

pI*:
6.80

Net Charge*:
-0.74

EC:
2.1.1.34  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits in gapped BLAST to conserved hypothetical protein (probable tRNA/rRNA methyltransferase); e.g. residues 1-244 are 80% similar to [1176354] hypothetical tRNA/rRNA methyltransferase of Haemophilus influenzae, residues 2-245 are 69% similar to (AE004327) RNA methyltransferase, TrmH family of Vibrio cholerae, residues 1-243 are % similar to [732016] hypothetical tRNA/rRNA methyltransferase yjfh of E.coli.

COGS Summary:  COGS Search
BeTs to 14 clades of COG0566
COG name: rRNA methylases
Functional Class: J
The phylogenetic pattern of COG0566 is a---YQvCEBRHujgpOLinx
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001537 (tRNA/rRNA methyltransferase (SpoU)) with a combined E-value of 1.5e-26.
    IPB001537A    98-122
    IPB001537B    194-202
    IPB001537C    225-238


ProDom Summary:  Protein Domain Search
Residues 5-90 are 38% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE) protein domain (PD119549) which is seen in Q9HUM8_PSEAE.

Residues 92-240 are 31% similar to a (METHYLTRANSFERASE 2.1.1.- RIBOSE) protein domain (PD149131) which is seen in PT56_YEAST.

Residues 53-129 are 79% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE RRNA) protein domain (PD016373) which is seen in YJFH_HAEIN.

Residues 1-51 are 76% similar to a (METHYLTRANSFERASE PROTEOME TRNA/RRNA) protein domain (PD403972) which is seen in Q9CJP3_PASMU.

Residues 138-228 are 83% similar to a (METHYLTRANSFERASE PROTEOME COMPLETE RRNA TRNA/RRNA) protein domain (PD001243) which is seen in Q9CJP3_PASMU.



Paralogs:  Local Blast Search
HD0270 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 95 to 237 (E-value = 6.3e-59) place HD0270 in the SpoU_methylase family which is described as SpoU rRNA Methylase family (PF00588)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MSEQIYGIHAVNAFLANAPERLIEVFVLKGREDKRLNPLLDELQRLSISV
QQVNRQTLDNKAQGEVHQGIIARIIPQKELNEYDLNELLQHKSNPLLLIL
DGVTDPHNLGACLRTADAAGVDAVIVPKDKSATLTAIARKVACGAAEAMP
LIRVTNLARTMRELQDKHQIWIVGTAGEATTDIYTSQLTGAIALVMGAEG
DGMRRLTREHCDQLVSIPMAGSVSSLNVSVATGVCLFEIVRQKLSR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTGAACAAATTTACGGCATTCACGCCGTAAACGCATTTTTAGCTAA
TGCACCTGAACGTCTAATTGAAGTATTTGTATTAAAAGGCCGAGAAGACA
AACGCCTTAATCCATTATTAGATGAATTACAACGTCTAAGCATTTCAGTT
CAACAAGTTAACCGCCAAACATTAGATAACAAAGCGCAAGGCGAAGTACA
TCAAGGTATTATTGCCAGAATTATTCCGCAAAAAGAATTAAATGAATATG
ATCTTAATGAGCTTCTTCAACACAAAAGCAATCCTTTGTTACTTATTTTA
GATGGTGTCACTGATCCGCATAATTTGGGCGCTTGCTTACGTACTGCCGA
TGCTGCGGGTGTAGATGCGGTGATTGTGCCCAAAGATAAGTCCGCAACAT
TAACAGCTATAGCACGAAAAGTAGCTTGTGGTGCAGCAGAGGCTATGCCC
TTAATCCGAGTTACCAACCTTGCTAGAACAATGCGTGAATTACAAGATAA
ACATCAAATTTGGATTGTTGGCACCGCTGGTGAAGCAACCACTGATATTT
ATACTAGCCAATTAACAGGTGCTATTGCCTTAGTTATGGGCGCAGAGGGT
GACGGTATGCGACGCTTAACACGAGAACACTGTGACCAACTAGTCAGTAT
TCCAATGGCTGGTTCAGTTTCATCTTTGAACGTTTCAGTCGCAACAGGCG
TCTGTTTATTTGAAATCGTTCGTCAAAAGTTAAGTAGATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy