Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR185 IGR189 IGR182 IGR184 IGR188 IGR186 IGR190 IGR187 IGR183 argR, - HD0262 lpp, - HD0266 HD0267 spoU,trmH, - HD0270 yfcH, - HD0261 pssA, - HD0271 ileS, - HD0272 mdh, - HD0264 obg, - HD0269 htrA, - HD0260 argS, - HD0268 argR, - HD0262 lpp, - HD0266 HD0267 spoU,trmH, - HD0270 yfcH, - HD0261 pssA, - HD0271 ileS, - HD0272 mdh, - HD0264 obg, - HD0269 htrA, - HD0260 argS, - HD0268 Type: tandem, Name:  - 5 Type: tandem, Name:  - 6 argR, - HD0262 lpp, - HD0266 HD0267 spoU,trmH, - HD0270 yfcH, - HD0261 pssA, - HD0271 ileS, - HD0272 mdh, - HD0264 obg, - HD0269 htrA, - HD0260 argS, - HD0268
* Calculated from Protein Sequence

Gene ID: HD0268

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
argS  

Definition:
arginyl-tRNA synthetase (argS)

Gene Start:
201977

Gene Stop:
203704

Gene Length:
1728

Molecular Weight*:
64331

pI*:
5.50

Net Charge*:
-8.92

EC:
6.1.1.19  

Functional Class:
Translation; Amino acyl tRNA synthetases and tRNA modification  

Pathway: pathway table
Aminoacyl-tRNA biosynthesis
Arginine and proline metabolism

Secondary Evidence:
Grundy FJ, Henkin TM.
Conservation of a transcription antitermination mechanism in aminoacyl-tRNA synthetase and amino acid biosynthesis genes in gram-positive bacteria.
J Mol Biol. 1994 Jan 14;235(2):798-804.
PMID: 8289305

Eriani,G., Dirheimer,G. and Gangloff,J.
Isolation and characterization of the gene coding for Escherichia
coli arginyl-tRNA synthetase
Nucleic Acids Res. 17 (14), 5725-5736 (1989)
Medline: 89345164


Comment:


Blast Summary:  PSI-Blast Search
Matches in gapped BLAST to arginyl-tRNA synthetases. Residues 1-575 are 77% similar to this enzyme from Haemophilus influenzae Rd (16273477|) and residues 15-575 are 77% similar to this enzyme from Pasteurella multocida (15602416|).

COGS Summary:  COGS Search
BeTs to 17 clades of COG0018
COG name: Arginyl-tRNA synthetase
Functional Class: J
The phylogenetic pattern of COG0018 is amtkYqvcebrhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 128-327 are 89% similar to a (SYNTHETASE LIGASE ARGINYL-TRNA) protein domain (PD002803) which is seen in SYR_PASMU.

Residues 515-574 are 81% similar to a (SYNTHETASE LIGASE ARGINYL-TRNA) protein domain (PD330902) which is seen in SYR_HAEIN.

Residues 158-357 are 25% similar to a (SYNTHETASE PROTEOME COMPLETE) protein domain (PD256250) which is seen in Q9HHN2_HALN1.

Residues 369-512 are 70% similar to a (SYNTHETASE LIGASE AMINOACYL-TRNA) protein domain (PD186118) which is seen in SYR_PASMU.

Residues 7-87 are 61% similar to a (SYNTHETASE LIGASE ARGINYL-TRNA) protein domain (PD003204) which is seen in SYR_HAEIN.

Residues 196-319 are 76% similar to a (SYNTHETASE LIGASE ARGINYL-TRNA) protein domain (PD332378) which is seen in Q9KQC6_VIBCH.



Paralogs:  Local Blast Search

HD0268 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 1 to 87 (E-value = 2.9e-29) place HD0268 in the Arg_tRNA_synt_N family which is described as Arginyl tRNA synthetase N terminal domain (PF03485)
Residues 99 to 446 (E-value = 6.1e-187) place HD0268 in the tRNA-synt_1d family which is described as tRNA synthetases class I (R) (PF00750)
Residues 460 to 575 (E-value = 9.5e-54) place HD0268 in the tRNA-synt_1d_C family which is described as DALR anticodon binding domain (PF05746)

PDB Hit:
pdb|1BS2|A Chain A, Yeast Arginyl-Trna Synthetase 250 2e-067

Gene Protein Sequence:
VNIQQILSDKIKQAMMIAGAEANVEPLVRQSSKPEFGDYQANGAMAAAKK
LAMNPREFAQKILDNLDVSDMVDKLEIAGPGFINIFLKPSWLAKQANFAL
QAVNFGIKTAQPQTILIDYSSPNVAKEMHVGHLRSTIIGDAVVRTLEFLG
NNVIRANHVGDWGTQFGMLIAYLEKMENEQASEMQLSDLEAFYRAAKESY
DSDQIFAEKARNYVVKLQSGDEYCRTMWKKLVDITMHHNQENYDRLNVTL
TEKDVMGESLYNPMLPEIVADLKAKGLAVEDNGAVVVFLDEFKNKDGDPM
GVIIQKSDGGFLYTTTDIAAAKYRYETLKVDRALVFSDSRQAQHMQQAWL
ITRKAGYVPASFSLEHPFFGMMLGKDGKPFKTRSGGTVKLKDLLDEAVER
ADKLISARSTNLTVAEKSAVVEAVAIGSVKYSDLSKNRTTDYVFDWDNML
TFEGNTAPYMQYAYTRIRSIFARAEIDPDTLTGEMQLTEEKERTLALKLL
QFEEALTAVAKEGMPHILCQYLYELAGIFSSFYEACPMLNADEAIKHSRL
RLASLTAKTLKQGLDLLGIKTVEKM$

Gene Nucleotide Sequence:  Sequence Viewer
GTGAATATTCAACAAATTTTATCAGACAAAATAAAACAAGCAATGATGAT
TGCTGGGGCTGAAGCAAATGTTGAGCCACTTGTTCGCCAATCTAGTAAGC
CAGAATTTGGTGATTATCAGGCAAATGGTGCAATGGCAGCCGCTAAAAAA
TTAGCAATGAATCCGCGAGAGTTTGCACAAAAGATTTTAGATAACCTTGA
TGTAAGTGATATGGTTGATAAATTAGAAATTGCTGGGCCTGGCTTTATTA
ATATTTTCTTAAAGCCAAGTTGGTTAGCAAAACAGGCTAATTTTGCATTG
CAAGCGGTTAATTTTGGTATTAAAACGGCTCAACCACAAACTATTTTGAT
TGATTACTCTTCGCCAAATGTAGCAAAAGAAATGCACGTTGGTCATTTAC
GTTCAACGATTATCGGTGATGCGGTCGTTCGTACGCTTGAATTTTTAGGC
AATAATGTGATCCGTGCTAATCACGTTGGTGATTGGGGAACCCAATTTGG
TATGTTAATTGCTTATCTTGAGAAAATGGAAAATGAGCAAGCCAGTGAGA
TGCAATTAAGTGATCTAGAAGCATTTTATCGGGCGGCTAAGGAATCTTAT
GATAGCGATCAGATTTTTGCTGAAAAAGCCCGTAATTATGTCGTTAAACT
ACAAAGTGGTGATGAATATTGTCGGACAATGTGGAAAAAGTTAGTCGATA
TTACTATGCACCATAATCAAGAAAATTACGACCGCTTAAATGTAACCTTG
ACAGAAAAAGACGTTATGGGTGAAAGTTTATATAATCCGATGTTGCCTGA
AATTGTTGCAGATCTAAAAGCCAAAGGATTAGCGGTTGAAGATAATGGTG
CTGTTGTTGTTTTCTTAGATGAATTTAAAAATAAAGATGGCGACCCGATG
GGCGTGATTATACAAAAAAGTGATGGTGGTTTTTTGTATACCACGACTGA
CATTGCCGCAGCTAAATATCGTTATGAAACATTAAAGGTCGATCGTGCTT
TGGTTTTCTCTGATTCTCGCCAAGCACAACATATGCAACAAGCGTGGTTA
ATCACCCGTAAAGCAGGTTATGTACCCGCATCATTTAGTCTTGAACATCC
ATTTTTTGGTATGATGTTAGGTAAAGATGGCAAGCCATTTAAAACGCGTT
CAGGTGGCACGGTTAAATTAAAAGATTTATTAGATGAAGCAGTAGAGCGC
GCAGATAAATTAATTTCAGCACGATCGACTAATTTAACTGTAGCAGAAAA
AAGCGCGGTAGTAGAAGCGGTCGCAATTGGCTCAGTTAAGTATTCCGATT
TATCCAAAAATCGCACGACAGACTATGTTTTTGATTGGGATAATATGTTG
ACTTTTGAAGGTAACACGGCCCCTTATATGCAGTATGCTTATACGCGTAT
TCGTTCAATTTTTGCACGTGCTGAGATTGATCCAGATACACTTACTGGCG
AAATGCAATTAACCGAAGAAAAAGAACGTACATTAGCGCTTAAATTATTG
CAATTCGAGGAAGCATTAACTGCCGTGGCTAAAGAGGGAATGCCACATAT
TCTTTGCCAATATTTATATGAATTAGCGGGGATTTTCTCAAGTTTCTATG
AAGCTTGCCCAATGTTAAATGCAGACGAAGCGATTAAGCATAGTCGTTTA
CGTTTGGCTAGTTTAACGGCGAAAACATTAAAACAAGGTTTAGATTTACT
TGGTATTAAAACAGTAGAAAAAATGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy