Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR178 IGR177 IGR180 IGR170 IGR174 IGR171 IGR179 IGR172 IGR176 IGR175 IGR173 IGR181 HD0254 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 yrbF, - HD0259 murA,murZ, - HD0253 purC, - HD0252 HD0247 purC, - HD0251 ftsW, - HD0246 htrA, - HD0260 HD0254 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 yrbF, - HD0259 murA,murZ, - HD0253 purC, - HD0252 HD0247 purC, - HD0251 ftsW, - HD0246 htrA, - HD0260 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 yrbF, - HD0259 murA,murZ, - HD0253 yrbE, - HD0258 yrbE, - HD0258 HD0254 purC, - HD0252 HD0247 purC, - HD0251 ftsW, - HD0246 htrA, - HD0260
* Calculated from Protein Sequence

Gene ID: HD0253

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
murA  murZ  

Definition:
UDP-N-acetylglucosamine enolpyruvyl transferase

Gene Start:
192937

Gene Stop:
191657

Gene Length:
1281

Molecular Weight*:
46002

pI*:
6.30

Net Charge*:
-5.31

EC:
2.5.1.7  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Aminosugars metabolism

Secondary Evidence:
Griffiths E, Gupta RS.
Protein signatures distinctive of chlamydial species: horizontal transfers of cell wall biosynthesis genes glmU from archaea to chlamydiae and murA between
chlamydiae and Streptomyces.
Microbiology. 2002 Aug;148(Pt 8):2541-9.
PMID: 12177347

Dai HJ, Parker CN, Bao JJ.
Characterization and inhibition study of MurA enzyme by capillary electrophoresis.
J Chromatogr B Analyt Technol Biomed Life Sci. 2002 Jan 5;766(1):123-32.
PMID: 11820287

Marquardt,J.L., Siegele,D.A., Kolter,R. and Walsh,C.T.
Cloning and sequencing of Escherichia coli murZ and purification of its product, a UDP-N-acetylglucosamine enolpyruvyl transferase
J. Bacteriol. 174 (17), 5748-5752 (1992)
Medline: 92380955

Skarzynski,T., Mistry,A., Wonacott,A., Hutchinson,S.E., Kelly,V.A.
and Duncan,K.
Structure of UDP-N-acetylglucosamine enolpyruvyl transferase, an
enzyme essential for the synthesis of bacterial peptidoglycan,
complexed with substrate UDP-N-acetylglucosamine and the drug
fosfomycin
Structure 4 (12), 1465-1474 (1996)
Medline: 97148340

Comment:
For other "mur" genes, see HD1906 (murI), HD0242 (murE), HD0243 (murF), HD0245 (murD), HD0081 (murB), HD0823 (murC), HD0824 (murG).

Blast Summary:  PSI-Blast Search
Numerous hits with gapped BLAST of UDP-N-acetylglucosamine 1-carboxyvinyltransferases; e.g. residues 1-421 are 78% similar to
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (U32788) of Haemopilus influzenzae, residues 1-419 are 72% similar to UDP-N-acetylglucosamine 1-carboxyvinyltransferase (Z11835) of Enterobacter cloacae, residues 1-419 are 71% similar to UDP-N-glucosamine 1-carboxyvinyltransferase (U18997) of E. coli.

COGS Summary:  COGS Search
BeTs to 11 clades of COG0766
COG name: UDP-N-acetylglucosamine enolpyruvyl transferase
Functional Class:  M
The phylogenetic pattern of COG0766 is -----qvceBrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 1-120 are 38% similar to a (TRANSFERASE UDP-N-ACETYLGLUCOSAMINE CELL) protein domain (PD404695) which is seen in MUA1_LACLA.

Residues 334-387 are 85% similar to a (TRANSFERASE UDP-N-ACETYLGLUCOSAMINE CELL) protein domain (PD332044) which is seen in MURA_PASMU.

Residues 261-333 are 41% similar to a (TRANSFERASE UDP-N-ACETYLGLUCOSAMINE CELL) protein domain (PD413614) which is seen in Q9KKF2_LISMO.

Residues 388-418 are 90% similar to a (TRANSFERASE UDP-N-ACETYLGLUCOSAMINE CELL) protein domain (PD005466) which is seen in MURA_HAEIN.

Residues 11-392 are 56% similar to a (TRANSFERASE SYNTHASE 1-CARBOXYVINYLTRANSFERASE) protein domain (PD001867) which is seen in Q9HVW7_PSEAE.



Paralogs:  Local Blast Search


HD0253 is paralogously related to HD1383 (3e-09).


Pfam Summary:  Pfam Search
Residues 8 to 408 (E-value = 5.4e-180) place HD0253 in the EPSP_synthase family which is described as EPSP synthase (3-phosphoshikimate 1-carboxyvinyltransferase) (PF00275)

PDB Hit:
pdb|1NAW|A Chain A, Enolpyruvyl Transferase >gi|2392465|pdb|1NA... 599 2e-172
pdb|1EYN|A Chain A, Structure Of Mura Liganded With The Extrins... 596 1e-171
pdb|1UAE| Structure Of Udp-N-Acetylglucosamine Enolpyruvyl Tr... 593 1e-170

Gene Protein Sequence:
MEKFRVHGPYKLSGTVDISGAKNAALPILFATILAEEPISLTNVPDLKDV
DTTFKILRKLGVVIERDANGVVQIDASHIQHYVAPYELVKTMRASIWALA
PLVARFHQGQVSLPGGCTIGARPVDMHITSLEKMGAIIELDEGYVKATAN
GRLQGARIYMDKVSVGATLSVMMAATLAEGSTIIENAAREPEIVDTAHFL
NAMGAEISGAGTDTITIKGKERLTGCQHHIVADRIETGTFLVAAAISGGK
ITCQGTKADTLDAVIEKLREAGMEVTVTENSITLDTKGQRPKAVNIRTMP
HPGFPTDMQAQFTLLNAVAEGTSRITETIFENRFMHIPELNRMGAKAEIE
GNTAICQGVEQLKPAEVMATDLRASISLVLAGCIASGETIVDRIYHIDRG
YEHIEEKLRRIGAKIERFRESASSAE$

Gene Nucleotide Sequence:  Sequence Viewer
ATGGAAAAATTTCGTGTTCACGGCCCTTATAAATTATCGGGTACGGTTGA
TATCTCAGGTGCTAAAAATGCAGCCCTACCTATCTTGTTTGCAACTATTT
TAGCAGAGGAGCCTATCAGCTTAACTAATGTACCCGATTTAAAAGATGTG
GACACTACCTTTAAAATCCTACGCAAATTAGGCGTGGTTATTGAACGTGA
TGCAAACGGCGTAGTCCAAATTGATGCAAGTCATATTCAACATTATGTAG
CGCCTTATGAATTGGTTAAAACAATGCGCGCATCAATTTGGGCATTAGCA
CCGCTTGTTGCACGCTTTCACCAAGGGCAAGTTTCATTACCAGGCGGCTG
CACTATAGGCGCACGTCCGGTTGATATGCATATTACTAGCCTCGAAAAAA
TGGGAGCAATTATTGAGCTTGACGAAGGCTATGTCAAAGCAACTGCCAAT
GGTCGCTTACAAGGTGCGCGTATCTATATGGATAAAGTCAGTGTAGGAGC
AACCCTATCAGTTATGATGGCCGCAACCCTCGCAGAAGGTTCGACTATCA
TTGAAAATGCCGCACGTGAACCTGAAATTGTCGATACTGCTCATTTTTTA
AATGCAATGGGAGCAGAAATCTCAGGTGCAGGAACAGATACGATCACAAT
TAAAGGTAAGGAACGCTTAACCGGTTGTCAGCATCATATCGTGGCAGATC
GTATTGAGACCGGCACATTTTTAGTTGCCGCGGCAATATCAGGCGGCAAA
ATTACTTGCCAAGGCACAAAAGCAGACACATTAGATGCCGTTATTGAGAA
ATTACGTGAAGCCGGTATGGAAGTGACTGTAACCGAGAATAGTATTACGC
TAGACACTAAAGGTCAACGACCTAAAGCGGTCAATATCCGCACTATGCCA
CACCCCGGTTTTCCTACTGATATGCAAGCACAATTTACTTTGTTGAATGC
GGTAGCAGAAGGCACAAGCCGAATCACTGAAACCATTTTTGAAAACCGTT
TTATGCACATTCCAGAATTGAATCGTATGGGAGCAAAAGCGGAAATAGAG
GGCAACACTGCCATTTGTCAGGGCGTTGAGCAATTAAAGCCGGCTGAAGT
AATGGCAACTGACTTACGTGCATCAATCAGTTTAGTATTAGCCGGTTGTA
TTGCATCAGGTGAAACCATTGTGGATCGGATCTACCATATTGATCGCGGT
TATGAACATATTGAAGAAAAGTTACGTCGCATTGGCGCTAAAATAGAACG
TTTTAGAGAATCTGCCAGTAGCGCTGAATAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy