Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR169 IGR178 IGR177 IGR180 IGR170 IGR174 IGR171 IGR179 IGR172 IGR176 IGR175 IGR173 HD0254 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 yrbF, - HD0259 murA,murZ, - HD0253 purC, - HD0252 HD0247 purC, - HD0251 ftsW, - HD0246 murD, - HD0245 HD0254 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 yrbF, - HD0259 murA,murZ, - HD0253 purC, - HD0252 HD0247 purC, - HD0251 ftsW, - HD0246 murD, - HD0245 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 yrbF, - HD0259 murA,murZ, - HD0253 yrbE, - HD0258 yrbE, - HD0258 HD0254 purC, - HD0252 HD0247 purC, - HD0251 ftsW, - HD0246 murD, - HD0245
* Calculated from Protein Sequence

Gene ID: HD0252

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purC  

Definition:
phosphoribosylaminoimidazole-succinocarboxamide synthase

Gene Start:
191334

Gene Stop:
191552

Gene Length:
219

Molecular Weight*:
8266

pI*:
4.50

Net Charge*:
-3.01

EC:
6.3.2.6  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Tiedeman,A.A., DeMarini,D.J., Parker,J. and Smith,J.M.
DNA sequence of the purC gene encoding
5'-phosphoribosyl-5-aminoimidazole-4-N-succinocarboxamide
synthetase and organization of the dapA-purC region of Escherichia
coli K-12
Journal of bacteriology. 172 (10), 6035-6041 (1990)
Medline: 91008982

Kilstrup,M., Jessing,S.G., Wichmand-Jorgensen,S.B., Madsen,M. and
Nilsson,D.
Activation control of pur gene expression in Lactococcus lactis:
proposal for a consensus activator binding sequence based on
deletion analysis and site-directed mutagenesis of purC and purD
promoter regions
J. Bacteriol. 180 (15), 3900-3906 (1998)
Medline: 98348452

Ebbole,D.J. and Zalkin,H.
Cloning and characterization of a 12-gene cluster from Bacillus
subtilis encoding nine enzymes for de novo purine nucleotide
synthesis
J. Biol. Chem. 262 (17), 8274-8287 (1987)
Medline: 87250425

Comment:


Blast Summary:  PSI-Blast Search
Significant hits to phosphoribosylaminoimidazol
-succinocarboxamide synthases (SAICAR synthetases) with gapped BLAST; e.g. residues 1-72 are 84% similar to phosphoribosylaminoimidazole-succinocarboxamide synthase (U32845) of Haemophilus influenzae Rd., residues 1-72 are 75% similar to
putative phosphoribosylaminoimidazole-succinocarboxamide (AL162754) of Neisseria meningitidis, residues 1-71 are 57% similar to phosphoribosylaminoimidazole-succinocarboxamide synthase (AL118514) of Sterptomyces coleicolor.

COGS Summary:  COGS Search
BeTs to 3 clades of COG0152
COG name: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
Functional Class: F
The phylogenetic pattern of COG0152 is amtkyqvcebrh--------x
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001636 (SAICAR synthetase) with a combined E-value of 1.1e-15.
    IPB001636F    0-15
    IPB001636G    28-37


ProDom Summary:  Protein Domain Search
Residues 1-55 are 83% similar to a (SYNTHASE SYNTHETASE SAICAR) protein domain (PD003043) which is seen in PUR7_HAEIN.



Paralogs:  Local Blast Search
HD0252 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
No significant hits to the Pfam 11.0 database

PDB Hit:
pdb|1A48| Saicar Synthase 73 6e-015

Gene Protein Sequence:
LMDEVLTPDSSRFWSVETYQEGINPPSFDKQFVRDWLANSGWNKQAPSPK
IPIDVIEKTVAKYQEALDLLTK$

Gene Nucleotide Sequence:  Sequence Viewer
TTGATGGATGAAGTGCTAACGCCAGATTCAAGCCGTTTTTGGTCGGTCGA
AACTTATCAAGAAGGGATAAATCCACCATCATTCGATAAACAATTTGTCC
GTGATTGGCTCGCAAATAGTGGTTGGAATAAACAGGCACCTTCTCCTAAA
ATTCCTATTGATGTAATTGAGAAAACGGTGGCTAAATATCAAGAAGCGTT
GGATCTATTGACTAAGTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy