Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR169 IGR178 IGR177 IGR180 IGR170 IGR174 IGR171 IGR179 IGR172 IGR176 IGR175 IGR173 HD0254 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 yrbF, - HD0259 murA,murZ, - HD0253 purC, - HD0252 HD0247 purC, - HD0251 ftsW, - HD0246 murD, - HD0245 HD0254 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 yrbF, - HD0259 murA,murZ, - HD0253 purC, - HD0252 HD0247 purC, - HD0251 ftsW, - HD0246 murD, - HD0245 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 murA,murZ, - HD0253 yrbE, - HD0258 yrbE, - HD0258 yrbF, - HD0259 HD0254 purC, - HD0252 HD0247 purC, - HD0251 ftsW, - HD0246 murD, - HD0245
* Calculated from Protein Sequence

Gene ID: HD0251

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
purC  

Definition:
phosphoribosylaminoimidazole-succinocarboxamide (SAICAR synthase)

Gene Start:
190760

Gene Stop:
191290

Gene Length:
531

Molecular Weight*:
19791

pI*:
6.50

Net Charge*:
-1.23

EC:
6.3.2.6  

Functional Class:
Purines, pyrimidines, nucleosides, and nucleotides; Purine ribonucleotide biosynthesis  

Pathway: pathway table
Purine metabolism

Secondary Evidence:
Jackson M, Berthet FX, Otal I, Rauzier J, Martin C, Gicquel B, Guilhot C.
The Mycobacterium tuberculosis purine biosynthetic pathway: isolation and characterization of the purC and purL genes. Microbiology 1996 Sep;142 (Pt9):2439-47.
Medline: 96425868.

Meyer E, Kappock TJ, Osuji C, Stubbe J.
Evidence for the direct transfer of the carboxylate of N5-carboxyaminoimidazole ribonucleotide (N5-CAIR) to generate
4-carboxy-5-aminoimidazole ribonucleotide catalyzed by Escherichia coli PurE, an N5-CAIR mutase.
Biochemistry. 1999 Mar 9;38(10):3012-8.
PMID: 10074353

Peltonen T, Mantsala P.
Isolation and characterization of a purC(orf)QLF operon from Lactococcus [correction of Lactobacillus] lactis MG1614.
Mol Gen Genet. 1999 Feb;261(1):31-41.
PMID: 10071207

Comment:
0

Blast Summary:  PSI-Blast Search
Significant hits to phosphoribosylaminoimidazol
-succinocarboxamide synthases (SAICAR synthetases) with gapped BLAST; e.g. residues 3-167 are 83% similar to phosphoribosylaminoimidazole-succinocarboxamide synthase (U32845)
of Haemophilus influenzae Rd, residues 2-167 are 75% similar to
putative phosphoribosylaminoimidazole-succinocarboxamide (AL162754) of Neisseria meningitidis, residues 5-167 are 49% similar to phosphoribosylaminoimidazole-succinocarboxamide synthase (AL118514) of Streptomyces coelicolor, residues 8-161 are
48% similar to purC (Z80226) of Mycobacterium tuberculosis.

COGS Summary:  COGS Search
BeTs to 10 clades of COG0152
COG name: Phosphoribosylaminoimidazolesuccinocarboxamide (SAICAR) synthase
Functional Class:  F
The phylogenetic pattern of COG0152 is amtkyqvcebrh--------x
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB001636 (SAICAR synthetase) with a combined E-value of 4.8e-52.
    IPB001636A    8-21
    IPB001636B    29-59
    IPB001636C    92-112
    IPB001636D    131-155


ProDom Summary:  Protein Domain Search
Residues 5-167 are 87% similar to a (SYNTHASE SYNTHETASE SAICAR) protein domain (PD003043) which is seen in PUR7_PASMU.



Paralogs:  Local Blast Search

HD0251 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 4 to 176 (E-value = 9.5e-51) place HD0251 in the SAICAR_synt family which is described as SAICAR synthetase (PF01259)

PDB Hit:
pdb|1A48| Saicar Synthase 147 9e-037

Gene Protein Sequence:
MQISLKKIYSGKVRDLYEIDDKRMLMVATDRLSAFDVILADPIPAKGEIL
TQISNFWFKKLEHIMPNHFTGDSVFDVLAKEEAEAIQHRAVVCKRLTPVK
IESIVRGYLTGSGLKDYQQTGSICGLALPAGLVEASKLPQPIFTPSSKAE
VGDHDVNISYEECEREICLNKRNYYL$

Gene Nucleotide Sequence:  Sequence Viewer
ATGCAAATTAGTTTAAAGAAAATTTATTCAGGCAAAGTGCGTGATTTATA
TGAAATTGATGATAAGCGGATGTTAATGGTTGCAACAGATCGTTTGTCAG
CCTTTGATGTTATTTTAGCGGATCCAATTCCTGCTAAAGGTGAAATCTTG
ACGCAAATCTCCAATTTTTGGTTTAAAAAACTTGAGCATATTATGCCAAA
TCATTTTACGGGTGATTCTGTTTTCGATGTGTTAGCTAAAGAAGAAGCTG
AGGCTATTCAACATCGCGCAGTGGTTTGTAAACGTTTAACACCTGTGAAA
ATTGAATCCATTGTGCGGGGTTATTTGACCGGTTCAGGCTTAAAAGATTA
TCAACAAACCGGTAGTATTTGTGGTTTAGCATTACCTGCCGGGTTAGTTG
AGGCGAGTAAATTACCACAACCTATTTTTACGCCGTCTAGTAAAGCTGAA
GTGGGTGATCACGATGTGAATATTTCATACGAAGAGTGTGAACGTGAAAT
ATGCCTTAACAAAAGGAATTATTATTTGTGA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy