Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR169 IGR178 IGR177 IGR170 IGR174 IGR171 IGR179 IGR168 IGR172 IGR176 IGR175 IGR173 HD0254 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 murA,murZ, - HD0253 purC, - HD0252 HD0247 purC, - HD0251 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 HD0254 HD0255 yrbD, - HD0257 HD0250 yrbC, - HD0256 map, - HD0248 murA,murZ, - HD0253 purC, - HD0252 HD0247 purC, - HD0251 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 HD0255 HD0250 yrbC, - HD0256 map, - HD0248 murA,murZ, - HD0253 HD0254 yrbD, - HD0257 purC, - HD0252 HD0247 purC, - HD0251 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243
* Calculated from Protein Sequence

Gene ID: HD0248

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
map  

Definition:
methionine aminopeptidase

Gene Start:
189824

Gene Stop:
189018

Gene Length:
807

Molecular Weight*:
30152

pI*:
6.80

Net Charge*:
-0.96

EC:
3.4.11.18  

Functional Class:
Translation; Protein modification and translation factors  

Pathway: pathway table

Secondary Evidence:
Rawlings ND, Barrett AJ. Evolutionary families of metallopeptidases.
Methods Enzymol 1995;248:183-228.
Medline: 95405261.

Structure of the cobalt-dependent methionine aminopeptidase from Escherichia coli: a new type of proteolytic enzyme.
Biochemistry 1993 Apr 20;32(15):3907-12.
Medline: 93229487.

Comment:


Blast Summary:  PSI-Blast Search
Numerous significant hits to methionine aminopeptidases (MAP"s) with gapped BLAST; e.g. residues 4-267 are 77% similar to methionine aminopeptidase (U32845) of Haemophilus influenzae, residues 4-255 are 69% similar to methionine aminopeptidase (X55778) of Salmonella typhimurium, residues 4-262 are 66% similar to methionine aminopeptidase (U70214) of E. coli.

COGS Summary:  COGS Search
BeTs to 16 clades of COG0024
COG name: Methionine aminopeptidase
Functional Class: J
The phylogenetic pattern of COG0024 is amtkYqvCeBRhujgpolinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
***** IPB002467 (Methionine aminopeptidase, subfamily 1) with a combined E-value of 1.5e-104.
    IPB002467A    33-50
    IPB002467B    62-83
    IPB002467C    89-117
    IPB002467D    162-187
    IPB002467E    196-208
    IPB002467F    220-250
    IPB002467A    141-158
***** PR00599 (Methionine aminopeptidase-1 signature) with a combined E-value of 2.5e-35.
    PR00599A    70-83
    PR00599B    93-109
    PR00599C    163-175
    PR00599D    194-206
***** IPB001131 (Proline dipeptidase) with a combined E-value of 4.1e-09.
    IPB001131B    93-114
    IPB001131C    168-180
    IPB001131D    196-209
    IPB001131E    232-250


ProDom Summary:  Protein Domain Search
Residues 37-182 are 79% similar to a (AMINOPEPTIDASE METHIONINE HYDROLASE MAP COBALT COMPLETE) protein domain (PD000555) which is seen in Q9CNH2_PASMU.

Residues 196-253 are 84% similar to a (AMINOPEPTIDASE METHIONINE MAP HYDROLASE COBALT COMPLETE) protein domain (PD102788) which is seen in Q9CNH2_PASMU.



Paralogs:  Local Blast Search
HD0248 has no significant similarity (blastp p-value < 1e-3) to any other gene in this genome.


Pfam Summary:  Pfam Search
Residues 167 to 240 (E-value = 4.5e-24) place HD0248 in the Peptidase_M24 family which is described as metallopeptidase family M24 (PF00557)

PDB Hit:
pdb|4MAT|A Chain A, E.Coli Methionine Aminopeptidase His79ala M... 368 5e-103
pdb|3MAT|A Chain A, E.Coli Methionine Aminopeptidase Transition... 368 5e-103
pdb|1C22|A Chain A, E. Coli Methionine Aminopeptidase: Trifluor... 368 5e-103

Gene Protein Sequence:
MSKIPLRNADEIQKIREACKLASEVLVMIEPYVKENITTGELDRICHEYI
VNQQQAISACLGYHGFPKSVCISVNEVVCHGIPSDDKKLKKGDIVNIDVT
VIKDGYFGDNSKMYVVGEANIRDKRLLEVTQEALYIGIRTVKAGIRLKEI
GKQIQRYVEKQGFSVVREYCGHGIGTEFHCDPQVLHYHSDDGGVVLQAGM
AFTIEPMVNAGKKEIRLMNDGWTVKTKDRSHSAQYEHQIVVTQDGCEIMT
IREEEIASGRVSRIMHNN$

Gene Nucleotide Sequence:  Sequence Viewer
ATGAGTAAAATTCCATTAAGAAATGCAGATGAAATTCAAAAAATTCGTGA
AGCCTGTAAATTAGCTTCCGAAGTATTAGTGATGATTGAGCCTTATGTAA
AAGAGAATATCACAACCGGTGAATTAGACCGCATTTGCCATGAATACATA
GTTAATCAGCAACAAGCTATTTCCGCTTGCTTAGGTTATCATGGTTTCCC
AAAATCAGTTTGTATCTCTGTCAATGAAGTTGTCTGCCACGGTATTCCAA
GCGATGATAAAAAGCTAAAAAAAGGCGATATTGTAAATATTGATGTAACT
GTGATTAAAGATGGCTATTTTGGAGACAACTCAAAAATGTATGTCGTTGG
AGAAGCTAATATTCGTGATAAACGCCTATTAGAAGTAACTCAAGAAGCGC
TTTACATCGGTATTCGCACGGTCAAAGCAGGTATTCGCTTAAAAGAGATT
GGCAAACAAATTCAACGATATGTAGAAAAACAAGGCTTTTCAGTGGTGAG
AGAATATTGCGGACACGGCATTGGCACTGAATTCCACTGTGATCCACAAG
TATTGCATTATCACTCTGATGATGGTGGTGTCGTTTTACAAGCTGGTATG
GCATTTACGATTGAACCGATGGTGAACGCTGGCAAAAAAGAAATCAGACT
AATGAATGATGGCTGGACAGTTAAAACCAAAGATCGTAGCCATTCAGCAC
AATATGAACACCAAATTGTTGTAACTCAAGACGGCTGTGAAATTATGACG
ATTCGTGAAGAAGAAATTGCCTCAGGCCGAGTAAGTCGTATTATGCATAA
TAACTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy