Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR169 IGR166 IGR170 IGR174 IGR167 IGR171 IGR168 IGR172 IGR175 IGR173 HD0250 map, - HD0248 purC, - HD0252 HD0247 purC, - HD0251 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 HD0250 map, - HD0248 purC, - HD0252 HD0247 purC, - HD0251 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 HD0250 map, - HD0248 HD0247 purC, - HD0251 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 purC, - HD0252
* Calculated from Protein Sequence

Gene ID: HD0245

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
murD  

Definition:
UDP-N-acetylmuramoylalanine--D-glutamate ligase

Gene Start:
185926

Gene Stop:
187233

Gene Length:
1308

Molecular Weight*:
46819

pI*:
5.20

Net Charge*:
-10.15

EC:
6.3.2.9  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
D-Glutamine and D-glutamate metabolism
Peptideglycan biosynthesis

Secondary Evidence:
Bertrand JA, Auger G, Fanchon E, Martin L, Blanot D, van Heijenoort J, Dideberg O.
Crystal structure of UDP-N-acetylmuramoyl-L-alanine:D-glutamate ligase from Escherichia coli.
EMBO J 1997 Jun;16(12):3416-25.
Medline: 97361823.

Comment:
For other "mur" genes, see HD1906 (murI), HD0242 (murE), HD0243 (murF), HD0253 (murA), HD0081 (murB), HD0823 (murC), HD0824 (murG).

Blast Summary:  PSI-Blast Search
Numerous hits to UDP-N-acetylmuramoylalanine--D-glutamate ligases;
e.g. residues 4-432 are 57% similar to UDP-N-acetylmuramoylalanine--D-glutamate ligase (U32793) of Haemophilus influenzae, residues 6-433 are 52% similar to UDP-N-acetylmuramoylalanine-D-glutamate ligase (D10483) of E. coli,residues 6-427 are 32% similar to UDP-N-acetylmuramoylalanine--D-glutamate ligase (AE002398) of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 12 clades of COG0771
COG name: UDP-N-acetylmuramoylalanine-D-glutamate ligase
Functional Class: M
The phylogenetic pattern of COG0771 is --T--qvcebrhuj--olinx
Number of proteins in this genome belonging to this COG is 1

Blocks Summary:  Blocks Search
No significant hits to the Blocks database.

ProDom Summary:  Protein Domain Search
Residues 7-134 are 70% similar to a (LIGASE CELL SYNTHETASE PEPTIDOGLYCAN SYNTHESIS) protein domain (PD001083) which is seen in Q9CPB0_PASMU.

Residues 155-221 are 68% similar to a (LIGASE SYNTHETASE CELL PEPTIDOGLYCAN SYNTHESIS ENZYME) protein domain (PD212530) which is seen in Q9KPG5_VIBCH.

Residues 13-65 are 56% similar to a (LIGASE) protein domain (PD406651) which is seen in MURD_ECOLI.

Residues 292-427 are 56% similar to a (LIGASE CELL) protein domain (PD039274) which is seen in MURD_HAEIN.



Paralogs:  Local Blast Search

HD0245 is paralogously related to HD0823 (7e-14), HD0243 (7e-08), HD0703 (6e-05) and HD0242 (6e-05).


Pfam Summary:  Pfam Search
Residues 44 to 289 (E-value = 3.3e-53) place HD0245 in the Mur_ligase family which is described as Mur ligase family, catalytic domain (PF01225)
Residues 298 to 377 (E-value = 2.2e-07) place HD0245 in the Mur_ligase_C family which is described as Mur ligase family, glutamate ligase domain (PF02875)

PDB Hit:
pdb|1E0D|A Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate ... 418 7e-118
pdb|3UAG|A Chain A, Udp-N-Acetylmuramoyl-L-Alanine:d-Glutamate ... 416 3e-117

Gene Protein Sequence:
MMQNQYQGKIITIVGLGKTGLSCVAFFAEKQATIQVIDTREQPAGIEHLS
DNVALHTGSLNLEWLLASDLIVMSPGLALATPEIQTAIQAGIEVVGDIEL
FVREAKAPIIAITGSNGKSTVTTLVSEMAQQAGIKVGMGGNIGIPALSLL
NKGYELFVLELSSFQLETTYSLKAKAATILNVSQDHMDRYASGEHYRQAK
LRIYENAEYVIVNDDDPLTYPLPSQSVGNLRHFAEHDAQYAIKYDQLCSG
DQAVINTDQMLLTGRHNQLNALAAIALAEAAGINRTGIINGLRCYGGLAH
RFQRVPTNDGVCWVNDSKATNVGSTVAALNGLPLSGTLYLLLGGDGKGAD
FSMLKALVNQPHIVCYCFGKDGKSLAELTTNSVLVDTMQQAIEQIRPLVK
QGDMVLLSPACASLDQFNNFEERGDMFARLAQQAV$

Gene Nucleotide Sequence:  Sequence Viewer
ATGATGCAAAATCAATATCAAGGCAAAATAATTACGATTGTCGGTTTAGG
TAAGACGGGCCTTTCTTGTGTGGCATTCTTTGCAGAAAAACAAGCAACAA
TACAAGTGATTGATACACGAGAACAACCTGCAGGAATTGAGCATTTATCA
GACAATGTCGCATTGCATACCGGTAGCCTAAACCTAGAGTGGCTATTAGC
GTCAGATTTAATTGTAATGAGTCCCGGTTTAGCATTAGCCACGCCCGAAA
TCCAAACCGCTATTCAGGCTGGTATTGAAGTTGTTGGTGATATTGAATTA
TTTGTCCGTGAGGCTAAAGCACCGATTATTGCGATTACTGGTTCAAATGG
TAAAAGTACAGTGACCACGCTAGTGAGTGAAATGGCACAACAAGCGGGCA
TAAAAGTCGGTATGGGTGGTAATATTGGTATTCCCGCCTTAAGTTTGTTA
AATAAAGGATATGAGCTGTTTGTGCTGGAACTTTCTAGTTTTCAGTTAGA
AACGACCTATTCTTTAAAAGCAAAGGCAGCAACCATTTTGAATGTTAGCC
AAGACCATATGGATCGCTATGCTTCAGGTGAGCATTATCGGCAAGCGAAA
TTGCGTATTTATGAAAATGCTGAATACGTGATTGTGAATGATGACGATCC
ACTTACTTATCCACTGCCGTCACAATCGGTGGGTAACTTGCGGCATTTTG
CGGAACATGATGCACAGTATGCTATAAAGTATGATCAGCTTTGCAGTGGT
GATCAAGCGGTGATTAATACGGATCAAATGTTATTAACAGGTCGCCATAA
TCAATTGAATGCTTTGGCTGCTATTGCTTTGGCAGAGGCAGCGGGCATTA
ATCGAACGGGCATTATCAATGGGTTACGCTGTTATGGTGGATTAGCTCAC
CGCTTTCAACGGGTGCCAACGAATGATGGTGTATGTTGGGTGAATGATTC
AAAAGCAACGAATGTTGGTAGTACAGTGGCTGCGTTAAATGGCTTACCGC
TATCAGGTACTCTTTATTTATTATTGGGTGGTGATGGAAAAGGGGCAGAT
TTTTCAATGTTAAAAGCATTAGTTAATCAGCCACATATTGTGTGTTATTG
CTTTGGTAAAGATGGAAAATCATTAGCTGAATTAACGACTAACAGTGTGT
TAGTGGATACCATGCAACAAGCAATTGAGCAAATTCGTCCGCTTGTTAAG
CAAGGGGATATGGTTTTGTTATCACCAGCGTGTGCCAGTTTAGATCAATT
TAATAATTTTGAAGAGCGTGGCGATATGTTTGCACGATTAGCGCAACAAG
CAGTTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy