Basic Search | Intermediate Search | Advanced SQL Search | Gene Image Map |  Home

Haemophilus ducreyi Search Results

Record: 1 of 1  
MiniMap IGR169 IGR166 IGR170 IGR167 IGR171 IGR168 IGR172 HD0250 map, - HD0248 HD0247 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 HD0250 map, - HD0248 HD0247 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241 HD0250 map, - HD0248 HD0247 mraY, - HD0244 ftsW, - HD0246 murD, - HD0245 murF,murN, - HD0243 murE, - HD0242 ftsI,pbp3,prc, - HD0241
* Calculated from Protein Sequence

Gene ID: HD0244

DNA Molecule Name:
1  

Genbank ID:
0

Gene Name:
mraY  

Definition:
UDP-MurNAc-pentapeptide phosphotransferase

Gene Start:
184764

Gene Stop:
185846

Gene Length:
1083

Molecular Weight*:
40230

pI*:
10.40

Net Charge*:
11.39

EC:
2.7.8.13  

Functional Class:
Cell envelope; Murein sacculus and peptidoglycan  

Pathway: pathway table
Peptideglycan biosynthesis

Secondary Evidence:
Dini C, Didier-Laurent S, Drochon N, Feteanu S, Guillot JC, Monti F, Uridat E, Zhang J, Aszodi J.
Synthesis of sub-micromolar inhibitors of MraY by exploring the region originally occupied by the diazepanone ring in the liposidomycin structure.
Bioorg Med Chem Lett. 2002 Apr 22;12(8):1209-13.
PMID: 11934590

Azzolina BA, Yuan X, Anderson MS, El-Sherbeini M.
The cell wall and cell division gene cluster in the Mra operon of Pseudomonas aeruginosa: cloning, production, and purification of active enzymes.
Protein Expr Purif. 2001 Apr;21(3):393-400.
PMID: 11281713

Branstrom AA, Midha S, Longley CB, Han K, Baizman ER, Axelrod HR
Assay for identification of inhibitors for bacterial MraY translocase or MurG transferase.
Anal Biochem. 2000 May 1;280(2):315-9.
PMID: 10790316


Comment:
0

Blast Summary:  PSI-Blast Search
Numerous significant hits to phospho-N-acetylmuramoyl- pentapeptide transferases; e.g. residues 1-346 are 70% similar to phosphop-N-acetylmuramoyl-pentapeptide-transferase E (U32793) of Haemophilus influenzae Rd.,residues 1-346 are 68% similar to phospho-N-acetylmuramoyl-pentapeptide transferase (D104483) of E. coli, residues 1-346 are 48% similar to phospho-N-acetylmuramoyl-
pentapeptide-transferase (AE002398) of Neisseria meningitidis.

COGS Summary:  COGS Search
BeTs to 15 clades of COG0472
COG name: UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N- acetylglucosamine-1-phosphate transferase
Functional Class: M
The phylogenetic pattern of COG0472 is -mTkyQVCEBRHUJ--olinX
Number of proteins in this genome belonging to this COG is 2

Blocks Summary:  Blocks Search
***** IPB003524 (Phospho-N-acetylmuramoyl-pentapeptide-transferase) with a combined E-value of 1.2e-154.
    IPB003524A    17-30
    IPB003524B    65-96
    IPB003524C    103-141
    IPB003524D    184-201
    IPB003524E    245-278
    IPB003524F    279-313
    IPB003524G    314-346


ProDom Summary:  Protein Domain Search
Residues 112-346 are 74% similar to a (TRANSFERASE TRANSMEMBRANE) protein domain (PD001416) which is seen in MRAY_PASMU.

Residues 189-267 are 38% similar to a (TRANSFERASE) protein domain (PD006173) which is seen in MRAY_TREPA.

Residues 28-88 are 83% similar to a (TRANSFERASE DIVISION TRANSMEMBRANE) protein domain (PD002261) which is seen in MRAY_HAEIN.



Paralogs:  Local Blast Search

HD0244 is paralogously related to HD1844 (1e-08).


Pfam Summary:  Pfam Search
Residues 98 to 290 (E-value = 8.5e-72) place HD0244 in the Glycos_transf_4 family which is described as Glycosyl transferase (PF00953)

PDB Hit:
No significant hits to the NCBI PDB database.

Gene Protein Sequence:
MLVWFAEYLLKYNTAFNVVSYISFRSIMALLTAMAIGLWIGPKVINRLQI
LKFGQEVRNDGPESHFKKRGTPTMGGIMILVSIGVSSLLWADLRNPYVWF
TLFVLFGYGIVGFVDDYWKIARKNTDGLVARWKYFWLSFIAFIAAFSMYA
MGKDTAATQLVVPFFKEVMPQLGLFYIILAYFVIVGTSNAVNLTDGLDGL
AIVPTIMVTAAFALIAWATGNIHAAEYLYIPYIRHSGELAIMCTAIVGAG
LGFLWYNTYPAQVFMGDVGSLSLGGALGVIAVLVRQELLLLVMGGVFVVE
ALSVILQVGSYKLRQKRIFRMAPIHHHFELKGWPEPRVIVRFWIITLVLV
LVGLVTLKLR$

Gene Nucleotide Sequence:  Sequence Viewer
ATGTTAGTTTGGTTTGCGGAATACCTTCTCAAATATAATACTGCATTTAA
TGTAGTATCTTATATCTCTTTTCGTTCAATTATGGCGTTATTAACCGCGA
TGGCAATAGGCTTATGGATTGGTCCTAAAGTAATTAATCGTTTGCAAATT
CTCAAGTTTGGTCAAGAAGTCCGTAATGATGGGCCAGAAAGCCATTTTAA
AAAACGTGGTACACCTACGATGGGGGGTATTATGATTTTGGTATCTATTG
GTGTGAGTTCATTGCTATGGGCAGATTTACGTAATCCTTATGTTTGGTTT
ACTTTATTTGTATTATTTGGTTATGGCATTGTGGGGTTTGTTGACGACTA
TTGGAAAATTGCACGTAAAAATACAGATGGCTTAGTCGCTCGTTGGAAAT
ATTTTTGGTTATCTTTTATTGCATTTATTGCCGCTTTTAGTATGTATGCT
ATGGGTAAAGATACGGCTGCAACACAATTAGTCGTGCCATTTTTTAAAGA
AGTTATGCCTCAATTAGGCCTTTTTTATATTATTTTAGCCTATTTTGTAA
TTGTTGGAACCAGTAATGCGGTTAATTTAACAGATGGGTTAGATGGCTTA
GCGATTGTGCCGACTATTATGGTAACGGCTGCATTTGCTTTAATTGCTTG
GGCTACGGGCAATATACATGCCGCTGAATATTTATATATTCCTTATATTA
GACATAGTGGTGAATTAGCGATTATGTGTACCGCTATTGTTGGTGCGGGC
TTGGGTTTCTTATGGTACAACACTTATCCTGCACAAGTATTTATGGGTGA
TGTAGGTTCATTATCACTAGGCGGTGCATTGGGCGTAATTGCCGTTTTGG
TCCGCCAGGAGTTGTTACTGCTTGTAATGGGCGGGGTTTTTGTTGTGGAA
GCGCTGTCGGTGATTTTACAAGTAGGCTCTTATAAACTTCGTCAGAAACG
GATTTTCCGAATGGCGCCTATTCATCATCATTTTGAATTAAAAGGTTGGC
CGGAGCCACGAGTGATTGTTCGTTTTTGGATCATTACATTAGTTTTAGTC
TTGGTCGGTTTAGTCACTTTAAAATTGCGTTAA


Los Alamos National Laboratory     
Operated by the University of California for the National Nuclear Security Administration,
of the US Department of Energy.     Copyright © 2001 UC | Disclaimer/Privacy